KEGG   Enterobacter kobei: BFV64_01675Help
Entry
BFV64_01675       CDS       T04686                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ekb  Enterobacter kobei
Pathway
ekb00564  Glycerophospholipid metabolism
ekb01100  Metabolic pathways
ekb01110  Biosynthesis of secondary metabolites
Module
ekb_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BFV64_01675
Enzymes [BR:ekb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BFV64_01675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_C48
Motif
Other DBs
NCBI-ProteinID: AOP85140
UniProt: A0A0F0XNK4
Position
complement(349449..350417)
Genome map
AA seq 322 aa AA seqDB search
MLNAFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMKEAQKPDTASY
RTFNEFFVRPLRDEVRPLNTDPNVLVMPADGVISQLGNIEDDKILQAKGHNYSLEALLAG
NYLMADLFRNGTFATTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGIIKRWTWPAGEAEGSVA
LLKGQEMGRFKLGSTVINLFAPGKVKLAEQLESLSVTKLGQPLAVSTETFVTPDAEPAPL
SQEEINAEHDASPLVDDKKDEG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaacgcatttaaactttcgcttcaatacattctgccaaaactgtggctcactcgc
ctggcgggctggggcgcaagcaaacgcgcgggctggctgaccaaactggtcatcgacctt
tttgtgaagtattacaaggtcgacatgaaagaggcacagaagccagacaccgccagctac
cgtaccttcaacgagttttttgtacgcccgctacgcgatgaagtgcgtccgctgaacacc
gaccctaacgtactggtgatgcccgctgacggcgtgatcagccagctgggtaatatcgaa
gacgacaaaatcctgcaggcgaaaggccataactacagcctggaagcgctgctggcgggt
aactacctgatggcggacctgttccgtaacggtacgtttgcgaccacctacctgtcgccg
cgcgactatcaccgcgtacacatgccgtgtaacggtatcctgcgtgagatgatctacgtt
ccgggcgatctcttctccgtgaaccacctgaccgcgcagaacgtaccgaacctgtttgcc
cgtaacgaacgcgtcatctgcctgttcgatactgaatttggcccgatggcgcaaattctg
gtgggcgcgaccattgtcggcagtattgaaaccgtctgggctggcaccatcacgcctccg
cgtgaaggtatcatcaaacgctggacgtggcctgctggtgaagcggaaggctctgtcgcc
ctgctgaaaggtcaggagatggggcgcttcaagctgggctctaccgttatcaacctgttt
gcgccgggcaaagtgaagctagctgaacagcttgaaagcctgtcggtgaccaaacttggc
cagccgctggcagtctccaccgaaacttttgtgacacccgatgcagaacctgctccgctg
tcacaagaagagatcaacgccgagcatgacgccagcccgctggttgacgacaaaaaagac
gaaggctaa

DBGET integrated database retrieval system