KEGG   Enterobacter kobei: BFV64_03185Help
Entry
BFV64_03185       CDS       T04686                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ekb  Enterobacter kobei
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BFV64_03185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AOP85422
UniProt: A0A0P8MY36
Position
complement(663498..663875)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVHVQSVYVESQSSPDEERFVFAYTVTIRNLGRMPVQLRGRYWLITNGNGREI
EVQGEGVVGEQPHIAPGEEYQYTSGAVIETPLGTMQGHYEMVDVDGNVFRVAIPVFRLAV
TTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtatgtgtccatgtacaaagcgtctatgttgaatcgcaatcc
tcacccgatgaagagcgttttgtctttgcttacaccgtgaccattcgcaatctggggcgg
atgcccgtgcagctgcgcgggcgctactggcttatcaccaacggcaatggccgcgaaatt
gaagttcagggtgaaggtgtcgtgggcgaacagccccacatcgcccctggcgaagagtac
cagtacaccagcggtgcggtgattgaaacgccgctgggtaccatgcaaggccattacgaa
atggtcgacgtcgatggcaatgtgttccgcgttgctattcctgtgttccgtctcgccgta
accacactcattcattaa

DBGET integrated database retrieval system