KEGG   Enterobacter kobei: BFV64_09275Help
Entry
BFV64_09275       CDS       T04686                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ekb  Enterobacter kobei
Pathway
ekb00480  Glutathione metabolism
ekb00590  Arachidonic acid metabolism
ekb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BFV64_09275
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BFV64_09275
Enzymes [BR:ekb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BFV64_09275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AOP86532
UniProt: A0A2J0PMR9
Position
1928805..1929356
Genome map
AA seq 183 aa AA seqDB search
MQTDILNTEVTTIDGEKTTLESYKGNVLLIVNVASKCGLTPQYEQLENIQKAWEKDGFTV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPMFSKIDVNGEDRHPLYAKLIAAAPKAVA
PEGSGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVVQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcagactgatatcctgaataccgaagtgacgaccattgatggcgagaaaaccacgctg
gaaagctacaaaggcaacgtgttgcttatcgtcaacgtggcgtccaaatgcggcctgacg
ccacagtacgaacagctggagaacattcagaaagcctgggagaaagacggtttcaccgtg
ctgggcttcccgtgcaaccagttcctgggccaggagccgggcagcgaagaagagatcaaa
accttctgcagcaccacctatggcgtaacgttcccgatgttcagcaaaattgatgttaac
ggcgaagatcgccatccgctgtacgcgaagctgattgctgccgcgccgaaggccgttgcg
cctgagggcagtggtttttacgagcgtatggccagcaaaggccgcgcgccgctctatccg
gacgatattctgtggaacttcgaaaaattcctgatcggtcgcgacggccaggtcgttcag
cgcttctcgccggatatgacgcctgaggatccgattgtcatggaatcgatcaagctggcg
ctggcaaaataa

DBGET integrated database retrieval system