KEGG   Enterobacter kobei: BFV64_17830Help
Entry
BFV64_17830       CDS       T04686                                 

Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ekb  Enterobacter kobei
Pathway
ekb00071  Fatty acid degradation
ekb00072  Synthesis and degradation of ketone bodies
ekb00280  Valine, leucine and isoleucine degradation
ekb00310  Lysine degradation
ekb00362  Benzoate degradation
ekb00380  Tryptophan metabolism
ekb00620  Pyruvate metabolism
ekb00630  Glyoxylate and dicarboxylate metabolism
ekb00640  Propanoate metabolism
ekb00650  Butanoate metabolism
ekb00900  Terpenoid backbone biosynthesis
ekb01100  Metabolic pathways
ekb01110  Biosynthesis of secondary metabolites
ekb01120  Microbial metabolism in diverse environments
ekb01130  Biosynthesis of antibiotics
ekb01200  Carbon metabolism
ekb01212  Fatty acid metabolism
ekb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFV64_17830
   00630 Glyoxylate and dicarboxylate metabolism
    BFV64_17830
   00640 Propanoate metabolism
    BFV64_17830
   00650 Butanoate metabolism
    BFV64_17830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BFV64_17830
   00072 Synthesis and degradation of ketone bodies
    BFV64_17830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFV64_17830
   00310 Lysine degradation
    BFV64_17830
   00380 Tryptophan metabolism
    BFV64_17830
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BFV64_17830
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BFV64_17830
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BFV64_17830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ekb04147]
    BFV64_17830
Enzymes [BR:ekb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BFV64_17830
Exosome [BR:ekb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BFV64_17830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOP89287
Position
3690789..3692054
Genome map
AA seq 421 aa AA seqDB search
MSRFAEPVFIAAGLRTPFGRGGGALAAYDAISLSVPVVQAMAAQAEPDLLVWGTVIPNLG
WSNIARETWLDAKLNPTVPAFSVVLACSTSMTATFAAAGMLGGGTDLTMVGGSEVMSRPS
IALTADASKRLTDLFAQDATAALAALQSLTPRDYVLPTKGWANRITGRTMGDHMEETAKA
WRVSRVAQDDWALKSHQRAVAGWERGFFDDLVISLPELARDANPRADTSPERLAALKPAF
DRDSGRGTLTAGNSSPITDGAAGCWVATEAGVARLPAGTPYARLVDYEISAVDLHTEGLL
MAPSYGIPRLLARHQLSFSDIALWEIHEAFAAQVLANVAAITDREWVRATAGVQAAMGDF
DWDRVNPNGGSVALGHPFGATGARDLSQAVKELWAMPPGSRAIVSICADGGQGTVALLER
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctttgccgaacccgtcttcattgccgctggccttcggacgcctttcggccgc
ggcggaggcgcgttggctgcctacgatgccatctctctgtccgtgcctgtcgtgcaggcg
atggcggcgcaggcggagcctgatctcctcgtctggggaaccgtgatcccgaatttgggc
tggagcaatattgctcgcgaaacctggcttgatgccaagctcaatccgactgttccggcg
ttctccgtcgtcctggcatgctcgaccagcatgacggcgaccttcgctgcggcagggatg
ctgggcggaggaaccgacctcaccatggtcggcgggtccgaagtcatgagccggccgtca
atcgccctgacggccgatgcatcgaagcggctcaccgacctctttgcgcaggatgcgacc
gccgcgcttgccgccctccagtctctgactccacgagactacgtgctccccacaaagggc
tgggcaaaccggatcaccggaaggacgatgggtgatcatatggaggagaccgccaaggct
tggcgggtctcgcgcgtcgcgcaggatgattgggcgctcaagagccaccagcgggcagtc
gctggttgggaacgtggcttcttcgacgatctcgtgatttcgctgcctgagctggcgcgc
gatgcgaacccgcgcgccgatacgtcgcccgaacggctggccgcactcaagcccgccttc
gatcgcgacagcgggaggggaaccctgaccgccggcaacagctcaccgattacggatgga
gccgccgggtgttgggtcgctaccgaagccggtgtggcgagactcccggcgggcaccccc
tacgcgcggctcgtcgactacgagatctctgccgtcgatctccacaccgagggcctgctg
atggcgccctcctatggcattccgcgcctgctcgcgcggcatcaactcagcttctccgac
atcgcactctgggaaatccacgaagcctttgcagcccaggtcctggcgaacgtcgcggcc
atcaccgatcgggagtgggtgcgcgcgacagccggtgtccaggcggctatgggcgatttt
gactgggaccgcgtcaatcccaatggaggctcggtcgccctgggtcatccgttcggcgct
acaggcgcgcgcgacctcagccaggcggtaaaggaactttgggccatgccgcccggatcg
cgcgcaatcgtcagcatctgcgccgacggcggtcaaggcacagtcgccctcctcgaacgc
ggctga

DBGET integrated database retrieval system