KEGG   Enterobacter kobei: BFV64_21755Help
Entry
BFV64_21755       CDS       T04686                                 

Definition
(GenBank) malonate decarboxylase subunit alpha
  KO
K13929  malonate decarboxylase alpha subunit [EC:2.3.1.187]
Organism
ekb  Enterobacter kobei
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ekb02000]
    BFV64_21755
Enzymes [BR:ekb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.187  acetyl-S-ACP:malonate ACP transferase
     BFV64_21755
Transporters [BR:ekb02000]
 Other Transporters
  Primary active transporters [TC:3]
   BFV64_21755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: AOP88811
Position
complement(4466006..4467661)
Genome map
AA seq 551 aa AA seqDB search
MLSGQTPTRQWNTRRSEKARRLASVPVQGKVLPTGDLVAMLEKLIAPGDKVVLEGNNQKQ
ADFLSRSLAEVNPQIVHDLHMIMPSVGRSEHLDIFEKGIARKLDFSFSGTQSLRISQLLE
DGQLEIGAIHTYIELYSRLYVDLSPNVALIAGFKADRKGNLYTGASTEDTPALVEAAAFH
DGIVIAQVNELVDDECDLPRVDIPGSWIDYVVVADKPFFIEPLFTRDPRLIKQEHILMAM
MAIKGIYAEHQVQSLNHGIGFNTAAIELLLPTYGEQLGLKGKICKHWTLNPHPTLIPAIE
SGWVESVHCFGGELGMEEYIRARPDIFFTGADGSMRSNRAFCQLAGQYAVDMFIGSTLQV
DGYANSSTVTRGRLSGFGGAPNMGHDPHGRRHATPAWLNMITEPDPMQRGKKLVVQMVET
FQAGVKTTFVEKLDAVDVAKASGMPLAPVMIYGDDVTHVLTEEGIAYLYRAKDLEERRAM
VAAVAGITDIGLGVDAKRVAELRQSGKVVYPEDMGIRRTDATRSLLAAGSVSDLVEWSGG
LYNPPAKFRSW
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgggcaaacacccacccggcaatggaacacgcgacgcagcgaaaaagcgcgt
cgtctggcgtccgtaccggtgcagggcaaggtactgccaaccggcgatcttgtcgccatg
ctggaaaaactgatcgcccctggcgataaggtcgttctggaaggtaacaaccagaagcag
gccgatttcctttcacgctcgctggctgaagtgaacccgcaaattgtccacgatctgcat
atgatcatgccgagcgtcggccgtagcgagcatctggatatctttgagaaaggcatcgcc
cgcaagctggacttctccttctccgggacgcagagcctgcgaatctcccagctgctggaa
gatggtcagctcgaaatcggcgctatccatacctatatcgagctctattcacgcctctac
gtcgacctctcgcccaacgtggcgctgattgcggggtttaaagcagaccgcaaaggcaac
ctctacaccggggcgagcaccgaagatactccggcactggtggaagccgcggccttccac
gacgggattgtgattgcgcaggtgaatgaactggtggacgacgaatgcgacctgccgcgc
gtcgatattccgggctcctggattgactatgttgtcgttgccgacaagccattctttatc
gaaccgctgtttacccgtgatccgcgactgatcaaacaggaacacatcctgatggcgatg
atggcgattaagggcatctacgcggaacatcaggtgcagtccctcaaccacgggatcggt
tttaacaccgcagcgattgaactgctgctgccgacctacggcgaacagctcggcctgaag
ggcaaaatctgtaagcactggaccctgaacccgcacccaacgctgatcccggcaattgaa
agcggctgggtggaaagcgtgcactgcttcggcggcgagctggggatggaagagtacatc
cgcgcccgtccggacatcttctttaccggtgccgacggctccatgcgttccaaccgtgcg
ttctgtcagctggccggtcagtatgcggtcgatatgtttatcggctcaactctgcaggtt
gatggttacgccaactcctcaacggtgacacgcggtcgtctttccggcttcggcggtgcg
ccaaacatggggcacgacccacatggtcgtcgccacgctacaccggcctggctgaacatg
atcaccgaacctgacccgatgcagcgcggtaaaaaactggtcgtgcagatggtggaaacc
ttccaggcgggcgtaaagacgacctttgtggaaaagcttgatgctgttgacgtggcaaaa
gcgtccgggatgcctctggcgccggtcatgatatacggcgacgacgtgacgcacgtgctg
acggaagaggggattgcttacctctatcgcgccaaagatcttgaggagcgtcgtgccatg
gtcgccgctgtggcggggattaccgatatcggcctgggcgtggatgctaaacgcgtggcg
gaactgcgccagagcggcaaggttgtttatccggaagatatgggtattcgccgcaccgac
gccacccgctctctgctggcggcgggcagcgtgtcagacctcgttgaatggtccggcggt
ctgtacaacccacctgcgaaattccggagctggtaa

DBGET integrated database retrieval system