KEGG   Enterobacter kobei: BFV64_22130Help
Entry
BFV64_22130       CDS       T04686                                 

Definition
(GenBank) 4-amino-4-deoxy-L-arabinose lipid A transferase
  KO
K07264  4-amino-4-deoxy-L-arabinose transferase [EC:2.4.2.43]
Organism
ekb  Enterobacter kobei
Pathway
ekb00540  Lipopolysaccharide biosynthesis
ekb01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BFV64_22130
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BFV64_22130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ekb01003]
    BFV64_22130
   01005 Lipopolysaccharide biosynthesis proteins [BR:ekb01005]
    BFV64_22130
Enzymes [BR:ekb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.43  lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase
     BFV64_22130
Glycosyltransferases [BR:ekb01003]
 Polysaccharide
  Bacterial polysaccharide
   BFV64_22130
Lipopolysaccharide biosynthesis proteins [BR:ekb01005]
 Lipid A
  BFV64_22130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_2
Motif
Other DBs
NCBI-ProteinID: AOP88882
Position
complement(4547171..4548826)
Genome map
AA seq 551 aa AA seqDB search
MKTARYGLALLALFIVYYLIPVDVRLLWQPDETRYAEISREMLASGDWIVPHFLGLRYFE
KPIAGYWINSLGQLLFGHTNFAVRAGAIFSTGLTALLVIWMAWRLWRDKRVAIFSGLIFL
TLFLAYGIGTYAVLDPIITLWLVAAMCSFWLASQAQTVAGKAGGYVLLGLACGMGVMTKG
FLALAVPVIGVLPWVIVQKRWKEVLIFGWLAILSCVLIVLPWALAIAHREPDFWRYFFWV
EHIQRFAQSDAQHKAPFWYYLPFLLAGSLPWLALLPGAFRLGWNDRQSAGGGFYLLGWVV
MPLLFFSIAKGKLPTYILPCFAPLAILMARYACLAAEKGARALRINGGINLAFGVIGVIA
ALVVSPWGLAKHPVWTPVELYKVFCAVVAFLLWAAVGWFTFRQSQQRWWLAALCPAGLAL
LIGFAIPNLVVDSKQPQSLVDTVREPLQESRFVLANNVGVAAGLAWELKRNDITLFGQSG
ELRYGLDYPDVKDRYVDKDDFAQWLATHRQQGRVSLVVLLSKRDDISRANLPQPDNLYIQ
GRFALLEYLPK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcccgttatggcttagcgcttctcgcactgtttatcgtttactacctcatt
cctgtcgatgtccgcctgctgtggcagcctgacgaaacgcgctatgcggaaatcagccgc
gaaatgctggcatcgggtgactggatcgtcccgcattttctggggctgcgttactttgaa
aaaccgattgctggctactggatcaacagtctcgggcagttgctgttcgggcacaccaac
tttgccgtacgcgccggggcgatattctccaccgggttaacggcgctgctggtgatctgg
atggcctggcgtctctggcgggataagcgagtagccattttctccggccttatcttcctg
accctgttcctggcgtacggtatcggcacgtatgcggtgctggatcctatcatcaccctg
tggctggtggcggcgatgtgcagcttctggctggcctcgcaggcccaaaccgtggccgga
aaagcgggtggctatgtgctgcttgggctggcctgcgggatgggggtgatgaccaaaggc
ttcctggcgctggccgttccggtgattggcgtgctgccgtgggtgatcgtccagaagcgc
tggaaagaggtgctgatttttggctggctcgcgatcctgagctgcgtgctgattgtcctg
ccgtgggcgctggcgattgcgcatcgggagcctgatttctggcgttacttcttctgggtt
gaacatattcagcgttttgcacagagcgacgcccagcataaagccccgttctggtattac
ctgccgttcctgcttgcgggcagcctgccgtggctggcactgctgccgggcgcgtttcgt
ctcggctggaatgacagacaaagcgcgggtggaggattctatctgctgggctgggtggtg
atgccgctgctgttcttcagcatcgccaaaggcaaactgccgacctacatcctgccctgt
tttgccccgctggctatcctgatggcgcgctatgcctgcctcgcggcggaaaaaggtgcg
agagcgttgcgcattaacggtgggattaacctggcgtttggggtgatcggcgtgattgcg
gcgctggtggtctcgccatgggggctggctaagcatccggtctggacgccggtcgaactg
tacaaagtgttctgtgcagtggtggcgttcctcctctgggccgcggtgggctggtttacg
ttcagacagagtcagcagcgctggtggctggcagccttgtgtcctgcaggcctggcgttg
ctgattggttttgccattcctaacctggtggtggattccaaacagccgcagtcgctggtc
gataccgtgcgcgagccgcttcaggaaagccgatttgtgctggccaataacgttggcgtg
gccgcgggtctggcgtgggagctgaagcgtaatgacattacgctgtttggtcagagcggc
gaactgcgttacgggctggattatcccgatgtgaaagatcgttacgtcgacaaagatgac
ttcgcgcagtggctggcgacgcatcgtcagcaggggcgtgtgtcgctggtggttctgctg
tcaaaacgtgacgatatctcacgggcgaatttaccgcagccggacaatctctatatccag
ggacggtttgccttgctggagtatctgccgaagtga

DBGET integrated database retrieval system