KEGG   Escherichia coli KO11FL: KO11_00550Help
Entry
KO11_00550        CDS       T02104                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00010  Glycolysis / Gluconeogenesis
ekf00020  Citrate cycle (TCA cycle)
ekf00620  Pyruvate metabolism
ekf01100  Metabolic pathways
ekf01110  Biosynthesis of secondary metabolites
ekf01120  Microbial metabolism in diverse environments
ekf01130  Biosynthesis of antibiotics
ekf01200  Carbon metabolism
Module
ekf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KO11_00550 (aceF)
   00020 Citrate cycle (TCA cycle)
    KO11_00550 (aceF)
   00620 Pyruvate metabolism
    KO11_00550 (aceF)
Enzymes [BR:ekf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KO11_00550 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AFH15099
Structure
PDB: 

Position
127254..129146
Genome map
AA seq 630 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPA
AKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILRED
VQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLS
FDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccgtctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaacccagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaagcagctccggcagcagcacca
gcggctgcagcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgataaagcgtctatggaagttccggctccgtttgctggcaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgtctaccggctcgctgattatggtcttcgaagtcgcg
ggtgaagcaggcgcggcagctccggcggctaaacaggaagcggctccggcagcggcccct
gcaccagcggctggcgtgaaagaagttaacgttccggatatcggaggtgacgaagttgaa
gtgaccgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgattacc
gtagaaggcgacaaagcttctatggaagttccggctccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggctcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcggcagctcctgcgaaacaggaagcggcagcgccggctccggca
gcaaaagctgaagctccggcagcagcaccggctgcgaaagcggaaggcaaatctgaattt
gcagaaaacgacgcttacgttcacgcgactccgctgatccgccgtctggcacgcgagttt
ggcgttaacctggcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagac
gttcaggcttacgtgaaagaagctatcaaacgtgcagaagcagctccggcggcgactggc
ggcggtatcccaggcatgctgccgtggccgaaggtggacttcagcaagtttggtgaaatc
gaagaagtggaactgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgg
gtgatgatcccgcatgttactcacttcgacaaaaccgatatcaccgagctggaagcgttc
cgtaaacagcagaacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggtt
gtcttcatcatgaaagccgttgctgcagctcttgagcagatgcctcgcttcaacagttcg
ttgtcggaagacggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtg
gataccccgaacggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatc
gagctgtctcgcgagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcg
ggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggtactacccac
ttcgcgccgattgtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatg
gagccggtgtggaatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctcc
ttcgaccaccgcgtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaac
acgctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system