KEGG   Escherichia coli KO11FL: KO11_01045
Entry
KO11_01045        CDS       T02104                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
ekf  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ekf02044]
    KO11_01045
Secretion system [BR:ekf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KO11_01045
SSDB
Motif
Pfam: VasL ImpA_N
Other DBs
NCBI-ProteinID: AFH15198
Position
complement(240905..242257)
AA seq 450 aa
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDL
HTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNIL
RQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTV
RGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLL
DTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLH
AFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNVMPEAATGTTAEK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaatagtaacgtactgacacaaactatcgttaccggcagtgacccgcgcgggctgccg
gaattcagtgccatccgcgaggaaataaacaaagccagccacccgtcacagcctgagctg
aactggaaactggtggagtcgctggcactggcgatttttaaagccaacggtgtggattta
cacaccgccacctactatacgcttgcccggacacggacacagggactggcgggattctgc
gaaggtgcggaactgctggcggcaatggtaagccacgactgggataagttctggccgcag
ggcggcccggcgcgtactgaaatgctggactggtttaactcccgaaccggcaatattctg
cgtcagcaaatctcctttgcggaatccgacctaccactgatctaccgcacagagcgggca
ttgcagcttatctgcgataagctccagcaggtggaactgaagcgcgttccgcgcgtggag
aatctgctctattttatgcagaacacgcgtaaacggcttgaaccccagctgaagagtaac
actgagaacgccgcacagaccacggtcagaacgctgatttatgccccggaaacacaggca
tcttccacaccagaagcggtagtgcctcccctgcccggcctgcctgagatgaaagtggaa
gtgcgcagtctgacagagaatcccccacaggccagtgtgataaagcaaggcagtacggta
agagggtttatcgcagggatcgcctgttcagtggctgtcgcctcagcattgtggtggtgg
caggtctatccggtacagcagcaactgttacaggttaacgacaccgctcagggcgcagca
acggtgtggatggcctcacctgaactcgaaaactatgagcgcaggctgcaacaacttctt
gatacctccccggtacagccgctggaaaccgggatgcagatgatgcgtgttgccgacagt
cgctggccggaaagcctgcaacagcaacaggcctcgacacaatggaatgaggcactcaaa
acccgcgcacagagtagcccgcagttgcgtggctggttgcagacccgccaggacttacat
gcttttgcagatctagtgatgcagcgcgagaaagagggactaaccctttcctatatcaaa
aatgtcatctggcaggcggagcggggactggggcaggaaacacccgttgagtctctgttg
acgcagtaccaggatgcccgtgcgcagaagcagaatacagatgcgctggaaaaacaaatt
aatgagcgactcgaaggcgtgttaagccgctggctgctgctgaagaataacgtcatgcca
gaggcggcaaccggtaccacggccgaaaaataa

DBGET integrated database retrieval system