KEGG   Escherichia coli KO11FL: KO11_01560Help
Entry
KO11_01560        CDS       T02104                                 

Gene name
frdB
Definition
(GenBank) fumarate reductase iron-sulfur subunit
  KO
K00245  fumarate reductase iron-sulfur subunit [EC:1.3.5.4]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00020  Citrate cycle (TCA cycle)
ekf00190  Oxidative phosphorylation
ekf00620  Pyruvate metabolism
ekf00650  Butanoate metabolism
ekf01100  Metabolic pathways
ekf01110  Biosynthesis of secondary metabolites
ekf01120  Microbial metabolism in diverse environments
ekf01130  Biosynthesis of antibiotics
ekf01200  Carbon metabolism
ekf02020  Two-component system
Module
ekf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ekf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ekf_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KO11_01560 (frdB)
   00620 Pyruvate metabolism
    KO11_01560 (frdB)
   00650 Butanoate metabolism
    KO11_01560 (frdB)
  Energy metabolism
   00190 Oxidative phosphorylation
    KO11_01560 (frdB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KO11_01560 (frdB)
Enzymes [BR:ekf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     KO11_01560 (frdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_16 Fer4_18 Fer4 Fer4_4 Fer2 Fer4_2 Fer4_6 Fer4_13 Fer4_21 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFH15303
Structure
PDB: 

Position
331183..331917
Genome map
AA seq 244 aa AA seqDB search
MAEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRM
AICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPY
IIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRY
NEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIAT
LKPR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgagatgaaaaacctgaaaattgaggtggtgcgctataacccggaagtcgatacc
gcaccgcatagcgcattctatgaagtgccttatgacgcaactacctcattactggatgcg
ctgggctacatcaaagacaacctggcaccggacctgagctaccgctggtcctgccgtatg
gcgatttgtggttcctgcggcatgatggttaacaacgtgccaaaactggcatgtaaaacc
ttcctgcgtgattacaccgacggtatgaaggttgaagcgttagctaacttcccgattgaa
cgcgatctggtggtcgatatgacccacttcatcgaaagtctggaagcgatcaaaccgtac
atcatcggcaactcccgcaccgcggatcagggtactaacatccagaccccggcgcagatg
gcgaagtatcaccagttctccggttgcatcaactgtggtttgtgctacgccgcgtgcccg
cagtttggcctgaacccagagttcatcggtccggctgccattacgctggcgcatcgttat
aacgaagatagccgcgaccacggtaagaaggagcgtatggcgcagttgaacagccagaac
ggcgtatggagctgtactttcgtgggctactgctccgaagtctgcccgaaacacgtcgat
ccggctgcggccattcagcagggcaaagtagaaagttcgaaagactttcttatcgcgacc
ctgaaaccacgctaa

DBGET integrated database retrieval system