KEGG   Escherichia coli KO11FL: KO11_04700Help
Entry
KO11_04700        CDS       T02104                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00051  Fructose and mannose metabolism
ekf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KO11_04700 (mtlD)
Enzymes [BR:ekf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     KO11_04700 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AFH15926
Position
complement(1008207..1009355)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYSLPHKNLIQGIAGAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDANSEVVSEAVTAYKAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcagacgcgggtatccaactgacgtttgccgatgtcaatcaggtggtacttgatgccctg
aatgcccgtcatagctatcaggttcatgtggttggtgaaaccgagcaggtagataccgtt
tccggcgtcaatgctgtcagcagcattggtgatgatgtcgttgatctgattgctcaggtc
gatttagtcactaccgccgttggcccggttgtgctggaacgtattgctccggctatcgcc
aaagggctggtgaaacgcaaagaacaaggtaatgaatccccgctgaacatcatcgcctgt
gaaaacatggtacgcggtaccacgcagctgaaaggccatgtgatgaacgccctgccggaa
gacgccaaagcgtgggtagaagaacacgttggctttgtcgattccgccgttgaccgcatc
gtaccgccttcggcttcggcaactaacgatccgctggaagtgacggtagaaactttcagc
gaatggattgtcgataaaacgcagttcaaaggcgcactgccgaacatcccaggcatggag
ttaaccgacaacctgatggcatttgtcgaacgtaaactcttcaccctgaacacgggtcat
gctataaccgcgtacctcggaaaactggccggtcatcagaccattcgtgacgctattctc
gacgagaaaatccgcgcggtggtaaaaggtgcgatggaagaaagtggtgcggtactgatc
aagcgctacggctttgacgcagacaaacatgcggcgtacatccagaaaatcctcggtcgt
tttgagaacccgtatctgaaagatgatgtagagcgcgtaggccgtcagccgctgcgtaaa
ctgagtgctggcgaccgtctgatcaagccactgctcggtacgctggaatacagccttccg
cacaagaatctgattcaggggattgctggtgcaatgcacttccgcagtgaagatgatccg
caggctcaggaactggcagcactgatcgctgacaaaggtccgcaggcggcgctggcacag
atttccggtcttgatgccaacagcgaggttgtatccgaggcggtaaccgcttataaagca
atgcaataa

DBGET integrated database retrieval system