KEGG   Escherichia coli KO11FL: KO11_08425
Entry
KO11_08425        CDS       T02104                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00230  Purine metabolism
ekf01100  Metabolic pathways
ekf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KO11_08425 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AFH16666
Position
complement(1790995..1791474)
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVQDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttcaggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system