KEGG   Escherichia coli KO11FL: KO11_08735Help
Entry
KO11_08735        CDS       T02104                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
ekf  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ekf02044]
    KO11_08735
Secretion system [BR:ekf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KO11_08735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AFH16728
Position
complement(1857830..1858258)
Genome map
AA seq 142 aa AA seqDB search
MSTPSLYEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLS
LIHQGMVAGIHGLMRQIEETLLRYEPRLSQIQVELLPQPRPGYLNYLIHAQLPDTGWIRF
DGVFSPEGRIVLRHLKQQERAY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaccttccttatatgaaatgctgacgttcagtttcagcggcgagttaccactg
gaacaggtcagcgagcgggatcagcttatcctttccgtgatggacaatatgcaacgcatt
atcaactgtcgggcaggcacactggcgcatttgccggattacggtctgccggatctcagt
ctgatccatcagggtatggttgcgggtattcatggcctgatgcgtcagattgaagaaacg
ctgctgcgttatgaaccacgcctgagtcagatacaggtggagttactcccccagccccgt
ccggggtatcttaattacctgatccacgcgcagcttcccgataccggctggatacgcttt
gatggcgtgttttctccggaaggacgaattgttctgcgtcatctcaaacagcaggagcgg
gcgtactga

DBGET integrated database retrieval system