KEGG   Escherichia coli KO11FL: KO11_08740
Entry
KO11_08740        CDS       T02104                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KO11_08740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ekf02044]
    KO11_08740
Secretion system [BR:ekf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KO11_08740
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AFH16729
Position
complement(1858262..1858798)
AA seq 178 aa
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALN
TDAEDTPLSTMVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLN
VPLDKETQFVAIIGQFYHPDEKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtttcctattcgttttaaacgtccggcgctgctctgtatggcgatgctgacggttgtt
ctgagcggctgcgggctgattcagaaagtggtggatgaatcgaaaagcgtggcctcagcc
gttttctacaagcaaatcaaaatactgcatctcgatttcttctcccgaagtgccctgaat
acggatgcggaagatacgccgctttccacgatggtgcatgtctggcaactgaaaacccgc
gaagattttgacaaggcggattatgacaccctgtttatgcaggaagagaagacgctggag
aaggacgtactggcaaaacacaccgtctgggtaaaaccggaaggcacggcatccctgaat
gtgccgctggataaagagacgcagtttgtcgccattattgggcagttttatcaccctgat
gaaaaaagcgacagctggcgtctggtgatcaaaagggacgaactggaggccgacaagccg
cgctcgattgaactgatgagaagcgacctgcgactgctgcctctcaaggataaataa

DBGET integrated database retrieval system