KEGG   Escherichia coli KO11FL: KO11_08815Help
Entry
KO11_08815        CDS       T02104                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KO11_08815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ekf02044]
    KO11_08815
Secretion system [BR:ekf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KO11_08815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: AFH16744
Position
complement(1870228..1873617)
Genome map
AA seq 1129 aa AA seqDB search
MVPGLNRLRPRSVSGPAIVMTVAVVVALCTFIHRKPALLGVEPGSSQQMYWMAGVIAAGV
VFLIIMGVYHLLNRHAAVQNFELRRQLAAGDDYRAVTTKKADSRHPAMVELAAFLRDRYG
PFWRRNVRLLLVTGEPEQAEAIAPGLTGQHWLEGDHTVLIYGGRPSAEPDVTLLTALKKL
RRSRPLDGIIWALTEEQSRQTAQLDKGWRELINGGKRLGFQAPLYLWQVCDNGDYQAGRP
LQSVGCLLPERCTPEQLTAMLEAHTLPLTEQGMSQLLADNRHDFLLRLAHTLAERGIAHW
QSVLKPLLAGGAFSSLRLRGLMFSPPLTAVPEAAPHAWLPSQVWAGVTGDNARGRAVGFP
WLRAALMSAVCVLAIWGAGMTTSFFANCALVQETSIQTARALDTRLPQAEQLVALHTLQG
ELERLQYRIREGAPWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVA
LPPNSPQRTATGEQRYKQLKALLMTSRPEKADAAFFSTTLMADSLRYENIPEGVRQSVFP
SLLTFWMANLPEHPQWKTSPPPELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYADM
TLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVVTARREEIDWVLSDRQQDT
SADISPDTLRNRLTSRYFTDFTGSWLAFLNSIRWKKEDSLSGILDQLTLMADARQSPLIA
LTDTLAWQAAAVRENRGLSDSLAKSAQELFNGKEKTPQQSREVDVPVGPLDKTFAPLLRL
LGDKAGGGGGDTQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTD
TRDYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFA
GRYPFKASQNDASLPLLAQYLRDDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNP
DFIRALNRLRDVADTAFASGDAGIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQRF
NWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQVTPVDSSTFKVVWKAQDG
LPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDAEEYGEDADE
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
gtggttccgggattaaaccgtctccggccccgttctgtttcagggcctgccatcgtcatg
accgtggctgttgtggttgcgctttgcacgtttattcaccgtaaaccggcattgctgggc
gttgaaccgggtagctcacagcaaatgtactggatggctggcgtgattgccgcaggcgtg
gtctttttgattatcatgggggtttatcatctgctgaaccgccacgctgccgtacaaaac
tttgaactccgcagacaacttgccgccggagatgactatcgtgcggtgacgacaaagaaa
gccgacagccgtcatccggcaatggtggaactcgccgccttcctgcgcgaccgctacggt
ccgttctggcggcgtaacgtccgcctgctgctggtgaccggcgagcctgaacaggcagaa
gccatcgcgccggggctgaccgggcaacactggctggagggcgaccacacggtgctgata
tatggcggcaggccatcagcggagcctgatgtcacactgctgaccgccttaaaaaaactg
cgccgcagccgtccgctggacggcatcatctgggcgctgacagaagaacagagccgccag
acagcgcaactcgacaaaggctggcgcgaactgataaacggcggtaagcgactcggtttt
caggccccactctatttgtggcaggtctgtgacaacggtgattatcaggccggacgcccc
ctgcaaagcgtcggctgcctgctgccggaacgctgcaccccggaacaactgaccgccatg
ctggaagctcacaccctgccgctgacggaacagggcatgtcgcaactgctggctgataac
cgccatgattttctgctgcgtctggcccatacccttgcagagcggggtatcgctcactgg
caaagcgtcctgaaaccgctgctggcaggcggcgcattctcttccctgcgcctgcgtggt
ctgatgttcagcccgccgcttaccgccgtaccggaggccgcacctcatgcgtggctgccg
tcacaggtctgggcgggcgtgaccggcgataacgcacgggggcgtgcagtgggctttccg
tggctacgcgccgcgctgatgtccgctgtctgcgtgctggcaatatggggggccggaatg
acgacctctttcttcgccaactgcgctcttgttcaggaaaccagcatccagactgcacgt
gcgcttgatacccgcctgccgcaggcagaacaactggtggcgctgcataccctgcagggc
gaactggagcgcctgcaatatcgtatccgcgaaggtgcgccgtggtatcagcgttttggc
cttgaacgtaaccaacaactgctcgcagccgcctttcccggctatgcgcaggcggcaaac
cggctggtgcgcgacgtggccgttgaccatctgcaacagcaactgaacgcctttgtcgcc
ctgccgcccaacagtcctcagcgtaccgccaccggtgaacaacgctataagcagcttaag
gcattgctgatgacttcccgcccggaaaaggccgacgctgcctttttcagtaccacgctg
atggcagacagcctgcgctacgagaatatcccggaaggtgtgcggcagagcgtgtttccg
tcactgctgaccttctggatggcgaacctgccggaacacccgcagtggaaaacctcgccg
ccaccggaactgaccggcgcggtgcgtaaaatcctgctgcgccagattggtgtgcgtaat
gccgaaaacactctctaccagaacgtactgcaacaggtgtcccgcaactacgccgatatg
acgctggcggacatgaccggggataccctcaccgaatctcttttcagtacggaacagacg
gtgccggggatgttcacccgtcaggcgtgggaaggacaggtcagggaagccatcgagcag
gtggtgacggcgcggcgcgaggaaatcgactgggtgctcagcgaccgccagcaggatacc
tctgcggatatatcgccggatacgctgcgtaaccgtctcacctcacgctactttaccgac
ttcaccggaagctggctggcgtttctcaacagcattcgctggaaaaaggaagactcgctc
tccggcattctcgaccagctgacactgatggccgatgcccgtcagtcgccgctgattgcg
ctgaccgataccctcgcgtggcaggcggcggcagtcagggaaaaccgtggcctgtcagac
tcgctggcgaaatcggcacaggaactgtttaacggcaaggagaaaacgccgcagcaatcc
cgtgaagtcgatgtgcctgtcgggccgctggataaaacctttgctccgctgctgcggttg
ctgggcgataaggccggaggcggtggtggtgatacgcaactcagcctgcaaacgtatctg
acccgcgtcacccgcgtacgcctcaaactgcaacaggtgaccaacgcccccgacccgcag
gaaatgacgcaacagctggcacagacggtactgcagggcaaaaccgttgacctcaccgac
acccgcgactacggacggttaatcgccgccagtctgggcgaggaatggagtggcttcggt
caggcgctgttcgtccgcccggtggagcagtcgtggcggcaggtgctgacgcctgcggcg
gacagcctgaaccgccagtggcagcgggcgattgtcagccactggaatcaggacttcgct
ggtcgctacccgttcaaagcctcacagaacgatgcctccctccccctgctggcgcagtat
ctgcgcgatgacgggcgcatcaaccagtttattgccgccaacctttccggcgttctgaaa
cgtgaaggccgctactgggtggcggacgccatgaacacgcaggggctgacggtcaacccg
gactttatccgcgccctgaaccgcctgcgcgacgtggctgacaccgcctttgccagcggc
gatgccggaatacattttgaactgcgggcaaaaccggcccgagacgtgatgaagacacat
ctggtgattgacgggcaggaactggagtatttcaaccagaaagaacgctggcagcgtttc
aactggccggatgaacagtggcaacccggcgcatcgctgagctggaccagtacgcaggcg
atggaacgcatactggcggattaccgggggagctggagccttattcgcctgctggaacag
gcgcaggtgacaccggtggacagcagcacctttaaagtggtgtggaaagcgcaggacggc
ctgccgctgaattacctgctgcgggttgaacagggtaaagggccgctggcgctgctggaa
ctgaaaaacttccgcctgccgggacaggtatttctgaccggcaggagtatgaaagatgcg
gaagaatacggggaagacgccgatgagtga

DBGET integrated database retrieval system