KEGG   Escherichia coli KO11FL: KO11_08860
Entry
KO11_08860        CDS       T02104                                 

Definition
(GenBank) Hcp-like protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KO11_08860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ekf02044]
    KO11_08860
Secretion system [BR:ekf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KO11_08860
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFH16753
Position
complement(1885630..1886121)
AA seq 163 aa
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFT
FTKEIDASSPYLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHD
IKEPSKEKHNHLERIEFRYEKITWTYKDGNIIHSDSWNERPSA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggctattcctgcttatctctggctgaaagatgacggcggcgcggatatcaaaggttcc
gtggacgttcaggggcgcgaaggcagcatcgaagtggtggcgctggatcacgatgtgtac
atcccgaccgacaacaacaccggcaaactgaccggtacccgtactcacaagccctttacg
tttaccaaagaaatcgatgcgtccagcccgtatctctacaaagcagtcaccaccggccag
accctgaaaacggcggaatttaagttttaccgcatcaacgatgccggtcaggaagtggag
tacttcaacatcacgctggataacgtcaagctggtcagagtcgctccgctgatgcacgac
atcaaggagccttccaaagagaagcataaccacctggaacgcattgagttccgctacgag
aaaatcacctggacttacaaagacggcaacatcattcattccgactcgtggaatgaacgt
ccttccgcctga

DBGET integrated database retrieval system