KEGG   Escherichia coli KO11FL: KO11_10945Help
Entry
KO11_10945        CDS       T02104                                 

Gene name
cscA
Definition
(GenBank) Sucrose-6-phosphate hydrolase (beta-fructofuranosidase) (Sucrase) (Invertase)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00052  Galactose metabolism
ekf00500  Starch and sucrose metabolism
ekf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KO11_10945 (cscA)
   00500 Starch and sucrose metabolism
    KO11_10945 (cscA)
Enzymes [BR:ekf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KO11_10945 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AFH17162
Position
complement(2333725..2335158)
Genome map
AA seq 477 aa AA seqDB search
MTQSRLHAAQNALAKLHEHRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHHPMS
EHWGPMHWGHATSDDMIHWQHEPIALAPGDDNDKDGCFSGSAVDDNGVLSLIYTGHVWLD
GAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGAKDP
GNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNAEGY
SYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFLAKDGRRIVIGWMDMWES
PMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSVSPRTISNKYVLQENAQ
AVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHENLDGYRSIPLPQRD
TLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVLQHGALWLLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatctcgattgcatgcggcgcaaaacgccctagcaaaacttcatgagcaccgg
ggtaacactttctatccccattttcacctcgcgcctcctgccgggtggatgaacgatcca
aacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcatccgatgagc
gaacactgggggccaatgcactggggacatgccaccagcgacgatatgatccactggcag
catgagcctattgcgctagcgccaggagacgataatgacaaagacgggtgtttttcaggt
agtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtctggctcgat
ggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagtcgggatggt
attcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatgcacttccgc
gatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcgaaagatcca
ggcaacacggggcagatcctgctttatcgcggcagttcgttgcgtgaatggaccttcgat
cgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccggactttttc
agccttggcgatcagcattatctgatgttttccccgcagggaatgaatgccgagggatac
agttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgccaggacgactt
tttgcacaatccgggcattttactgaacttgataacgggcatgacttttatgcaccacaa
agctttttagcgaaggatggtcggcgtattgttatcggctggatggatatgtgggaatcg
ccaatgccctcaaaacgtgaaggatgggcaggctgcatgacgctggcgcgcgagctatca
gagagcaatggcaaacttctacaacgcccggtacacgaagctgagtcgttacgccagcag
catcaatctgtctctccccgcacaatcagcaataaatatgttttgcaggaaaacgcgcaa
gcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacattacggatta
cagctcggcactggaatgcggctgtatattgataaccaatctgagcgacttgttttgtgg
cggtattacccacacgagaatttagacggctaccgtagtattcccctcccgcagcgtgac
acgctcgccctaaggatatttatcgatacatcatccgtggaagtatttattaacgacggg
gaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactgtcgctttat
gcctcccacggagtggctgtgctgcaacatggagcactctggctactgggttaa

DBGET integrated database retrieval system