KEGG   Escherichia coli KO11FL: KO11_13445Help
Entry
KO11_13445        CDS       T02104                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00030  Pentose phosphate pathway
ekf00480  Glutathione metabolism
ekf01100  Metabolic pathways
ekf01110  Biosynthesis of secondary metabolites
ekf01120  Microbial metabolism in diverse environments
ekf01200  Carbon metabolism
Module
ekf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ekf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ekf_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KO11_13445 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KO11_13445 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ekf04147]
    KO11_13445 (zwf)
Enzymes [BR:ekf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     KO11_13445 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     KO11_13445 (zwf)
Exosome [BR:ekf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KO11_13445 (zwf)
  Exosomal proteins of colorectal cancer cells
   KO11_13445 (zwf)
  Exosomal proteins of bladder cancer cells
   KO11_13445 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFH17663
Position
2873068..2874543
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQLNPDTRIIGVGRADWDKAAYTK
VVREALETFMKETIDEGLWDTLSARLDFCNLDVNDTAAFSRLGAMLDQKNRITINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQNHL
LQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcctgtgacctggtcattttcggcgcgaaaggcgac
cttgcgcgtcgtaaattgctgccttccctgtatcaactggaaaaagccggtcagctcaac
ccggacacccggattatcggcgtagggcgtgctgactgggataaagcggcatataccaaa
gttgtccgcgaggcgctcgaaactttcatgaaagaaaccattgatgaaggtttatgggac
accctgagtgcacgtctggatttttgtaatctcgatgtcaatgacactgctgcattcagc
cgtctcggcgcgatgctggatcaaaaaaatcgtatcaccattaactactttgccatgccg
cccagcacttttggcgcaatttgcaaagggcttggcgaggcaaaactgaatgctaaaccg
gcacgcgtagtcatggagaaaccgctggggacgtcgctggcgacctcgcaggaaatcaat
gatcaggttggcgaatacttcgaggagtgccaggtttaccgtatcgaccactatcttggt
aaagaaacggtgctgaacctgttggcgctgcgttttgctaactccctgtttgtgaataac
tgggacaatcgcaccattgatcatgttgagattaccgtggcagaagaagtggggatcgaa
gggcgctggggctattttgataaagccggtcagatgcgcgacatgatccagaaccacctg
ctgcaaattctttgcatgattgcgatgtctccgccgtctgacctgagcgcagacagcatc
cgcgatgaaaaagtgaaagtactgaagtctctgcgccgcatcgaccgctccaacgtacgc
gaaaaaaccgtacgcgggcaatatactgcgggcttcgcccagggcaaaaaagtgccggga
tatctggaagaagagggcgcgaacaagagcagcaatacagaaaccttcgtggcgatccgc
gtcgacattgataactggcgctgggccggtgtgccattctacctgcgtactggtaaacgt
ctgccgaccaaatgttctgaagtcgtggtctatttcaaaacacctgaactgaatctgttt
aaagagtcgtggcaggatctgccgcagaataaactgactatccgtctgcaacctgatgaa
ggcgtggatatccaggtactgaataaagttcctggccttgaccacaaacataacctgcaa
atcaccaagctggatctgagctattcagaaacctttaatcagacgcatctggcggatgcc
tatgaacgtttgctgctggaaaccatgcgtggtattcaggcactgtttgtacgtcgcgac
gaagtggaagaagcctggaaatgggtagactccattactgaggcgtgggcgatggacaat
gatgcgccgaaaccgtatcaggccggaacctggggacccgttgcctcggtggcgatgatt
acccgtgatggtcgttcctggaatgagtttgagtaa

DBGET integrated database retrieval system