KEGG   Escherichia coli KO11FL: KO11_15540Help
Entry
KO11_15540        CDS       T02104                                 

Gene name
sad
Definition
(GenBank) putative succinate semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00250  Alanine, aspartate and glutamate metabolism
ekf00650  Butanoate metabolism
ekf00760  Nicotinate and nicotinamide metabolism
ekf01100  Metabolic pathways
ekf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KO11_15540 (sad)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KO11_15540 (sad)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KO11_15540 (sad)
Enzymes [BR:ekf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     KO11_15540 (sad)
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     KO11_15540 (sad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: AFH18077
Position
3284743..3286131
Genome map
AA seq 462 aa AA seqDB search
MTITPATHAISINPATGEQLSVLPWAGANDIENALQLAAAGFRDWRETNIDYRAEKLRGI
GKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLKAEPTLVENQQA
VIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAPNVMGCAQLIAQVFKDAG
IPQGVYGWLNADNDGVSQMIKDSRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIASAFTERFVAAAAALKMGDP
RDEENALGPMARFDLRDELHHQVEKTLAQGARLLLGGEKMAGAGNYYPPTVLANVTPEMT
AFREEMFGPVAAITVAKDAEHALELANDSEFGLSATIFTTDETQARQMAARLECGGVFIN
GYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVWKDRI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccattactccggcaactcatgcaatttcgataaatcctgccacgggtgaacaactt
tctgtgctgccgtgggctggcgctaacgatatcgaaaacgcacttcagctggcggcagca
ggctttcgcgactggcgcgagacaaatatagattatcgtgctgaaaaactgcgtggtatc
ggtaaggctctgcgcgcccgtagcgaagaaatggcgcaaatgatcacccgtgaaatgggc
aaaccaatcaatcaggcgcgcgctgaagtggcgaaatcggcgaatttgtgtgactggtat
gcagaacatggtccggcaatgctgaaggcggaacctacgctggtggaaaatcagcaggca
gttattgagtatcgaccgttggggacgattctggcgattatgccgtggaactttccgtta
tggcaggtgatgcgtggcgcggttcccatcattcttgcaggtaacggctacttacttaaa
catgcgccgaatgtgatgggctgtgctcagctcattgcccaggtgtttaaagatgcggga
atcccgcaaggcgtatatggctggctgaatgccgacaacgacggtgtcagtcaaatgatt
aaagattcgcgcattgctgctgtcacggtgaccggaagtgttcgtgcgggagcggctatt
ggcgcacaggctggagcggcactgaaaaaatgcgtactggaactgggcggttcggatcca
tttattgtgcttaacgatgccgatctggaactggcggttaaagcggcggtagccggacgt
tatcagaataccggacaggtttgtgcagcggcaaaacgctttattatcgaagagggaatt
gcttctgcatttaccgaacgttttgtggcagctgcggcagccttgaaaatgggcgatccc
cgtgatgaagagaacgctctcggaccaatggctcgttttgatttacgtgatgagctgcat
catcaggtggagaaaaccctggcgcagggtgcgcgtttgttactgggcggggaaaagatg
gctggggcaggtaattactatccgccaacggttctggcgaatgttaccccagaaatgacc
gcgtttcgggaagaaatgtttggccctgttgcggcaatcaccgttgcgaaagatgcagaa
catgcgctggaactggctaatgatagtgagttcggcctttcagcgaccatttttaccacc
gacgaaacacaggccagacagatggcggcacgtctggaatgcggtggggtgtttatcaat
ggttattgtgccagcgacgcgcgagtggcctttggtggcgtgaaaaagagtggctttggt
cgtgagctttcccatttcggcttacacgaattctgtaatatccagacggtgtggaaagac
cggatctga

DBGET integrated database retrieval system