KEGG   Escherichia coli KO11FL: KO11_18985Help
Entry
KO11_18985        CDS       T02104                                 

Gene name
pdc-20
Definition
(GenBank) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00010  Glycolysis / Gluconeogenesis
ekf01100  Metabolic pathways
ekf01110  Biosynthesis of secondary metabolites
ekf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KO11_18985 (pdc-20)
Enzymes [BR:ekf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     KO11_18985 (pdc-20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AFH18764
Position
4022160..4023866
Genome map
AA seq 568 aa AA seqDB search
MSYTVGTYLAERLVQIGLKHHFAVAGDYNLVLLDNLLLNKNMEQVYCCNELNCGFSAEGY
ARAKGAAAAVVTYSVGALSAFDAIGGAYAENLPVILISGAPNNNDHAAGHVLHHALGKTD
YHYQLEMAKNITAAAEAIYTPEEAPAKIDHVIKTALREKKPVYLEIACNIASMPCAAPGP
ASALFNDEASDEASLNAAVEETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFADALGGAV
ATMAAAKSFFPEENPHYIGTSWGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPD
PKKLVLAEPRSVVVNGVRFPSVHLKDYLTRLAQKVSKKTGALDFFKSLNAGELKKAAPAD
PSAPLVNAEIARQVEALLTPNTTVIAETGDSWFNAQRMKLPNGARVEYEMQWGHIGWSVP
AAFGYAVGAPERRNILMVGDGSFQLTAQEVAQMVRLKLPVIIFLINNYGYTIEVMIHDGP
YNNIKNWDYAGLMEVFNGNGGYDSGAGKGLKAKTGGELAEAIKVALANTDGPTLIECFIG
REDCTEELVKWGKRVAAANSRKPVNKLL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgagttatactgtcggtacctatttagcggagcggcttgtccagattggtctcaagcat
cacttcgcagtcgcgggcgactacaacctcgtccttcttgacaacctgcttttgaacaaa
aacatggagcaggtttattgctgtaacgaactgaactgcggtttcagtgcagaaggttat
gctcgtgccaaaggcgcagcagcagccgtcgttacctacagcgtcggtgcgctttccgca
tttgatgctatcggtggcgcctatgcagaaaaccttccggttatcctgatctccggtgct
ccgaacaacaatgatcacgctgctggtcacgtgttgcatcacgctcttggcaaaaccgac
tatcactatcagttggaaatggccaagaacatcacggccgcagctgaagcgatttacacc
ccagaagaagctccggctaaaatcgatcacgtgattaaaactgctcttcgtgagaagaag
ccggtttatctcgaaatcgcttgcaacattgcttccatgccctgcgccgctcctggaccg
gcaagcgcattgttcaatgacgaagccagcgacgaagcttctttgaatgcagcggttgaa
gaaaccctgaaattcatcgccaaccgcgacaaagttgccgtcctcgtcggcagcaagctg
cgcgcagctggtgctgaagaagctgctgtcaaatttgctgatgctctcggtggcgcagtt
gctaccatggctgctgcaaaaagcttcttcccagaagaaaacccgcattacatcggtacc
tcatggggtgaagtcagctatccgggcgttgaaaagacgatgaaagaagccgatgcggtt
atcgctctggctcctgtcttcaacgactactccaccactggttggacggatattcctgat
cctaagaaactggttctcgctgaaccgcgttctgtcgtcgttaacggcgttcgcttcccc
agcgttcatctgaaagactatctgacccgtttggctcagaaagtttccaagaaaaccggt
gctttggacttcttcaaatccctcaatgcaggtgaactgaagaaagccgctccggctgat
ccgagtgctccgttggtcaacgcagaaatcgcccgtcaggtcgaagctcttctgaccccg
aacacgacggttattgctgaaaccggtgactcttggttcaatgctcagcgcatgaagctc
ccgaacggtgctcgcgttgaatatgaaatgcagtggggtcacatcggttggtccgttcct
gccgccttcggttatgccgtcggtgctccggaacgtcgcaacatcctcatggttggtgat
ggttccttccagctgacggctcaggaagtcgctcagatggttcgcctgaaactgccggtt
atcatcttcttgatcaataactatggttacaccatcgaagttatgatccatgatggtccg
tacaacaacatcaagaactgggattatgccggtctgatggaagtgttcaacggtaacggt
ggttatgacagcggtgctggtaaaggcctgaaggctaaaaccggtggcgaactggcagaa
gctatcaaggttgctctggcaaacaccgacggcccaaccctgatcgaatgcttcatcggt
cgtgaagactgcactgaagaattggtcaaatggggtaagcgcgttgctgccgccaacagc
cgtaagcctgttaacaagctcctctag

DBGET integrated database retrieval system