KEGG   Escherichia coli KO11FL: KO11_19580Help
Entry
KO11_19580        CDS       T02104                                 

Gene name
yliJ
Definition
(GenBank) putative transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00480  Glutathione metabolism
ekf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KO11_19580 (yliJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ekf02000]
    KO11_19580 (yliJ)
Enzymes [BR:ekf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KO11_19580 (yliJ)
Transporters [BR:ekf02000]
 Other transporters
  Pores ion channels [TC:1]
   KO11_19580 (yliJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_2 GST_C_5 GST_N_4 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: AFH18882
Position
4135957..4136583
Genome map
AA seq 208 aa AA seqDB search
MITLWGRNNSTNVKKVLLTLEELELPYEQILAGREFGINHDADFLAMNPNGLVPLLRDDE
SDLILWESNAIVRYLAAQYGQKRLWIDSPARRAEAEKWMDWANQTLSNAHRGILMGLVRT
PPEERDQAAIDASCKECDALFALLDAELAKVKWFSGDEFGVGDIAIAPFIYNLFNVGLTW
TPRPNLQRWYQQLTERPAVRKVVMIPVS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattacgctgtggggtcggaataattcaactaacgtaaaaaaagtattgctgacgctc
gaagaactggaactaccttatgagcaaattctcgcgggccgtgagtttgggataaatcac
gatgctgattttctggcgatgaaccctaacgggctggtgccgttgttgcgtgacgacgaa
agtgatctcattctttgggaatcaaacgccattgtccgctatctggcggcacagtacggg
caaaaacgcctgtggatcgactcaccggcacgtcgtgcggaagcggaaaaatggatggac
tgggcaaaccagacactcagtaatgctcatcgcgggatcctgatgggattagtcagaaca
ccacccgaagagcgcgatcaggccgccattgatgccagttgcaaagagtgcgacgccctg
tttgccctgctcgatgcggaactggcaaaagtaaaatggttctctggcgacgagtttggt
gtgggcgatatcgctatcgcaccgttcatctacaatttgtttaacgttggcctgacctgg
acaccgcgtccaaatctgcaacgctggtatcagcaactcactgaacgccccgcagtgcgc
aaagtggtgatgattcccgttagctaa

DBGET integrated database retrieval system