KEGG   Escherichia coli KO11FL: EKO11_0921
Entry
EKO11_0921        CDS       T01718                                 

Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
eko  Escherichia coli KO11FL
Pathway
eko03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:eko00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EKO11_0921
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eko03400]
    EKO11_0921
Enzymes [BR:eko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EKO11_0921
DNA repair and recombination proteins [BR:eko03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EKO11_0921
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_11 Cas_Cas2CT1978
Other DBs
NCBI-ProteinID: ADX49562
Structure
PDB: 
3K70 5MBV 5LD2 1W36

Position
959975..963517
AA seq 1180 aa
MSDVAETLDPLRLPLQGERLIEASAGTGKTFTIAALYLRLLLGLGGSAAFPRPLTVEELL
VVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLEEIDDKAQAAQWLLLAERQ
MDEAAVFTIHGFCQRMLNLNAFESGMLFEQQLIEDESLLRYQACADFWRRHCYPLPREIA
LVVFETWKGPQALLRDINRYLQGEAPVIKAPPPDDETLASRHAQIVARIDTVKQQWRDAV
GELDALIESSGIDRRKFNRSNQAKWIEKISAWAEEETNSYQLPESLEKFSQRFLEDRTKA
GGETPRHPLFEAIEQLLAEPLSIRDLVITRALAEIRETVAREKRRRGELGFDDMLSRLDS
ALRSESGEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRIWHHQPETALLLIGDPKQAIY
AFRGADIFTYMKARSEVHAHYTLDTNWRSAPGMVNSVNKLFSQTDDAFMFREIPFIPVKS
AGKNQALRFVFKGETQPAMKMWLMEGESCGVGDYQSTMAQVCAAQIRDWLQAGQRGEALL
MNGDDARPVRASDISVLVRSRQEAAQVRDALTLLEIPSVYLSNRDSVFETLEAQEMLWLL
QAVMTPERENTLRSALATSMMGLNALDIETLNNDEHAWDVVVEEFDGYRQIWRKRGVMPM
LRALMSARNIAENLLATAGGERRLTDILHISELLQEAGTQLESEHALVRWLSQHILEPDS
NASSQQMRLESDKHLVQIVTIHKSKGLEYPLVWLPFITNFRVQDQAFYHDRHSFEAVLDL
NAAPESVDLAEVERLAEDLRLLYVALTRSVWHCSLGVAPLVRRRGDKKGDTDVHQSALGR
LLQKGEPQDAAGLRTCIEALCDDDIAWQTAQTGDNQPWQVNDALTAELNARTLQRLPGDN
WRVTSYSGLQQRGHGIAQDLMPRLDVDAAGVVSVVEEPTLTPHQFPRGASPGTFLHSLFE
DLDFTQPVDPNWVQEKLELGGFESQWEPVLTEWITAVLQAPLNETGVSLSQLSDRDKQVE
MEFYLPISEPLIASQLDALIRQFDPLSAGCPPLEFMQVRGMLKGFIDLVFRHEGRYYLLD
YKSNWLGEDSSAYTQQAMAAAMQAHRYDLQYQLYTLALHRYLRHRIADYDYDRHFGGVIY
LFLRGVDKEHPQQGIYTTRPNAGLIALMDEMFAGMTLEEA
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgagtgatgtcgccgagacactagatcctttgcgcttgcccttacagggcgagcgcctg
attgaagcctctgccggcacaggcaaaacctttacgattgcggcgctctatttgcgcctg
ttacttggactaggcggttccgccgcctttccccgcccgctgaccgttgaagaactgctg
gtggtcacctttaccgaggctgccacggcagaattgcgcggtcgtatccgtagcaatatc
cacgagttgcgcatcgcctgtctgcgtgaaaccaccgacaatccactgtacgaacgcctg
ctggaagagatcgacgataaagcgcaagccgcgcagtggttgttgttagccgaacggcag
atggatgaagcggcagtctttactattcacggtttttgccagcgcatgctcaacctgaat
gcctttgaatccggtatgctgtttgagcagcagctgattgaagatgagtctctgctacgc
taccaggcctgcgccgatttctggcgtcgccactgctacccgctgccgcgtgaaattgcc
ctggtggtctttgaaacctggaaagggccgcaggcgttgctgcgcgatattaatcgttat
ctgcaaggcgaagcaccggttatcaaagcaccgccgcccgatgatgaaacgctggcttcc
cgccacgcgcaaattgtggcgcgtattgatacggtaaaacagcagtggcgcgacgcagtg
ggtgaactggatgcgctgatcgaatcttctggtattgatcgacgcaagtttaaccgtagc
aatcaggctaaatggatcgagaagatcagcgcctgggcagaagaagagaccaacagttat
cagttaccggagtcgctggaaaaattctctcagcgtttcttagaagatcgcacgaaagcc
gggggggaaaccccgcgacatccactgtttgaggcgatcgaacaactgcttgcagaacca
ttgtcgatccgtgatctggtgataacccgcgcattggctgagatccgcgaaacagtagcg
cgtgaaaaacgccgccgtggcgaattgggttttgatgacatgttaagtcggctcgattcc
gcgctgcgtagcgaaagcggcgaggtgttggcagcggcgatccgtacgcgattcccggtg
gcaatgattgatgaatttcaggataccgacccccagcagtaccgaatttttcgccgtatc
tggcaccatcagccggaaaccgcattgttgctgattggcgacccgaaacaggccatatat
gcattccggggtgcggatatcttcacttatatgaaggcgcgtagcgaagttcacgcccac
tacactttagacaccaactggcgttccgcaccaggaatggtgaacagtgtgaacaagctt
ttcagccagactgatgacgcgttcatgtttcgcgaaataccgtttattccagtgaaatca
gccgggaaaaatcaggcgttacgttttgtgtttaaaggtgaaacgcagcctgcgatgaaa
atgtggctgatggaaggcgaaagctgcggcgttggcgactatcaaagtaccatggcgcag
gtatgtgctgcgcaaatccgcgactggctacaagccggacagcggggcgaagcgttgctg
atgaacggcgacgacgcgcgtccggtgcgtgcttcggacatcagtgtgctggtgcgcagc
cgccaggaggccgcccaggtgcgcgacgccttaacgttgctggaaatcccttccgtttac
ctttcgaaccgcgacagtgtttttgaaactctggaagcgcaggaaatgctttggttgttg
caggcggtgatgacgcccgaacgtgagaacaccctgcgtagtgcgctggcaacgtcaatg
atggggctgaacgcgctggatatcgaaacgctgaacaatgacgaacatgcgtgggatgtg
gtagtcgaagagttcgatggttatcggcaaatctggcgcaaacgtggcgttatgccgatg
ctgcgggcgctgatgtcggcgcgtaacattgctgaaaacttgctggcaacggcaggcggt
gagcggcgtcttaccgatatcttgcatatcagcgaactgctacaagaagccggaacgcag
ctggaaagtgaacatgcgctggtacgctggttatcgcaacatatcctcgagccagacagt
aatgcctccagccaacaaatgcgtctcgaaagtgataaacatctggtgcagattgtcacg
atccacaaatcgaaagggctggaatatccattggtctggctgccgtttatcaccaatttc
cgcgtccaggatcaggcgttttatcacgatcgccactcgtttgaggcagttttggatctt
aacgctgcgccagaaagcgtcgacctcgcggaggtcgaacgtctggcggaagatctgcgt
ttgctttacgtggcgctgacgcgttcggtttggcattgcagtctcggcgttgcaccgctg
gtgcgccgtcgtggcgataaaaaaggtgacaccgacgtccaccaaagtgcgctcgggcgt
ttgctgcaaaaaggggaaccgcaagatgcggcagggcttcgcacctgtattgaagcgtta
tgcgatgatgatattgcctggcaaacggcacaaactggtgataaccagccctggcaggtt
aatgatgctttaactgcagaactgaatgcgaggacactacaacgattgcccggcgataac
tggcgtgtcaccagctactccggcttgcagcagcgtggtcacggtatcgctcaggatctg
atgccacggctggatgttgatgccgcaggcgtggtcagcgtcgttgaagaaccgacgtta
acaccgcatcagttcccgcgcggtgcgtcaccggggacattcttgcacagtttgtttgaa
gacctcgattttacccagccggttgacccgaactgggtacaggaaaaactggaactcggc
ggctttgaatcgcagtgggaaccggtgttgaccgagtggatcacggctgtcctccaggca
cctctcaatgaaacgggtgttagcctgagtcagctttccgaccgcgataaacaggtggag
atggagttttacctgccgattagcgaaccgctcatcgccagccagcttgatgcactaatt
cgccagtttgacccgctatccgctggctgcccgccgctggagttcatgcaggtacgcggc
atgttaaaaggctttatcgacctggtattccgccacgaagggcgttattacctgctcgac
tataaatccaactggctgggtgaagacagttcggcttacacccaacaggctatggcagca
gcgatgcaggcacaccgctatgatctgcaatatcagctttataccctggcgctgcatcgt
tatctgcgccatcgcattgctgattacgactatgatcgtcactttggcggcgttatctat
ctgttcctgcgtggcgttgataaagaacatccgcaacaagggatttacacaacccgaccc
aacgccgggttgattgccctgatggatgagatgtttgccggtatgaccctggaggaggcg
taa

DBGET integrated database retrieval system