KEGG   Escherichia coli KO11FL: EKO11_0923
Entry
EKO11_0923        CDS       T01718                                 

Definition
(GenBank) amino-acid N-acetyltransferase
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00220  Arginine biosynthesis
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01210  2-Oxocarboxylic acid metabolism
eko01230  Biosynthesis of amino acids
Module
eko_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EKO11_0923
Enzymes [BR:eko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     EKO11_0923
SSDB
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 pP_pnuc_2
Other DBs
NCBI-ProteinID: ADX49564
Position
complement(965405..966736)
AA seq 443 aa
MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLV
VVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLDITARLSMSLNNTP
LQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDSGAIVLMGPVAVSV
TGESFNLTSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEK
GDYNSGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRR
ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKI
GEMACVAVHPDYRSSSRGEVLLERITAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDL
LPESKKQLYNYQRKSKVLMADLG
NT seq 1332 nt   +upstreamnt  +downstreamnt
gtggtaaaggaacgtaaaaccgagttggtcgagggattccgccattcggttccctatatc
aatacccaccggggaaaaacgtttgtcatcatgctcggcggtgaagccattgagcatgag
aatttctccagtatcgttaatgatatcgggttattgcacagcctcggcatccgtctggtg
gtggtctatggcgcacgtccgcagatcgacgcaaatctggctgcgcatcaccacgaaccg
ctgtatcacaagaatatacgtgtgaccgacgccaaaacactggaactggtgaagcaggct
gcgggaacattgcaactggacatcactgctcgcctgtcgatgagtctcaataacacgccg
ctacagggcgcgcatatcaacgtcgtcagtggcaattttattattgcccagccgctgggc
gtcgatgacggcgtggattactgccatagcgggcgtatccggcggattgatgaagacgcg
atccatcgtcaactggacagcggtgcaatagtgctaatggggccggtcgctgtttcagtc
actggcgagagctttaacctgacctcggaagagattgccactcaactggccatcaaactg
aaagctgagaagatgattggtttttgctcttcccagggcgtcactaatgacgacggtgat
attgtctccgaacttttccctaacgaagcgcaagcgcgggtagaagcccaggaagagaaa
ggcgattacaactccggtacggtgcgctttttgcgtggcgcagtgaaagcctgccgcagc
ggcgtgcgtcgctgtcatttaatcagttatcaggaagatggcgcgctgttgcaagagttg
ttctcacgcgacggtatcggtacgcagattgtgatggaaagcgccgagcagattcgtcgc
gcaacaatcaacgatattggcggtattctggagttgattcgcccactggagcagcaaggt
attctggtacgccgttctcgcgagcagctggagatggaaatcgacaaattcaccattatt
cagcgcgataacacgactattgcctgcgccgcgctctatccgttcccggaagagaagatt
ggggaaatggcctgtgtggcagttcacccggattaccgcagttcatcacggggcgaggtt
ctgctggaacgcattaccgctcaggcgaagcagagcggcttaagcaaattgtttgtgctg
accacgcgcagtattcactggttccaggaacgtggatttaccccggtggatattgattta
ctgcccgagagcaaaaagcagttgtacaactaccagcgtaaatccaaagtgttgatggcg
gatttagggtaa

DBGET integrated database retrieval system