KEGG   Escherichia coli KO11FL: EKO11_0924
Entry
EKO11_0924        CDS       T01718                                 

Definition
(GenBank) cell wall hydrolase/autolysin
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
eko  Escherichia coli KO11FL
Pathway
eko01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:eko00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EKO11_0924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eko01011]
    EKO11_0924
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eko03036]
    EKO11_0924
Enzymes [BR:eko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     EKO11_0924
Peptidoglycan biosynthesis and degradation proteins [BR:eko01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   EKO11_0924
Chromosome and associated proteins [BR:eko03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    EKO11_0924
SSDB
Motif
Pfam: Amidase_3 AMIN
Other DBs
NCBI-ProteinID: ADX49565
Structure
PDB: 
4BIN

Position
966968..968221
AA seq 417 aa
MSGSNTAISRRRLLQGAGAMWLLSVSQVSLAAVSQVVAVRVWPASSYTRVTVESNRQLKY
KQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQN
VKPQLFALAPVAGFKERLVMDLYPANAQDMQDPLLALLEDYNKGDLEKQVPPAQSGPQPG
KAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNE
DIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQN
ASDLIGGVSKSGDRYVDHTMFDMVQSLTIADSLKFGKAVLNKLGKINKLHKNQVEQAGFA
VLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESILAGIKAYFADGATLARRG
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtcaggatccaacactgcaatcagccgtcgtcgtttactgcaaggcgcgggtgccatg
tggctattgagcgtaagtcaggtcagtctggctgcggtcagccaggtcgtggcggtgcgc
gtctggcctgcgtccagctacacccgcgtgacggtggaatcaaatcgtcagctgaaatat
aagcagttcgcgttgagtaaccctgaacgcgtggtggtggatatcgaagatgtaaacctg
aactcggtactcaaggggatggcggcacaaattcgtgcagacgacccgttcatcaagtcg
gcgcgcgtcgggcaatttgacccgcaaaccgtacggatggtttttgaattaaagcaaaac
gtaaaaccgcagctgtttgcccttgcgccggtcgccgggtttaaagagcgtctggtgatg
gacctctatccggccaatgcacaggatatgcaggacccgctgctggcgctgctggaggat
tacaacaaaggcgacctcgaaaagcaggtgccgccagcgcaaagtggtccacaaccgggt
aaagcagggcgcgatcgtccgattgtcattatgcttgaccctggccacggtggcgaagac
tccggtgcggtggggaaatacaaaacgcgcgaaaaagatgtggtattgcaaatagctcgc
cgtttgcgctctctgatcgagaaagagggcaatatgaaggtgtacatgacgcgcaatgaa
gacatcttcattccattgcaagtgcgcgtagcaaaagcccagaaacagcgtgctgacctg
tttgtctctatccatgccgacgcctttaccagtcgtcagccgagcggttcctctgtgttt
gcgctctcaaccaaaggtgcaaccagtactgcggcaaaatatctggcacaaacccagaac
gcctcggacttgattggtggcgtgagcaaaagcggtgaccgctatgtcgaccacaccatg
ttcgatatggtacagtcgctgaccattgccgacagcctgaagtttggtaaagcggtactg
aataagctcggtaaaatcaacaagctgcataaaaatcaagttgaacaggccgggtttgcc
gtactaaaggcaccagatattccctccattctggtcgaaacggcgtttatcagtaacgtt
gaggaagagcgtaaactgaaaacggcgactttccagcaggaagttgcggagtctattctt
gcgggaattaaagcgtattttgccgatggggcgacgctggcgagaaggggatga

DBGET integrated database retrieval system