KEGG   Escherichia coli KO11FL: EKO11_0925
Entry
EKO11_0925        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: ROS_MUCR HTH_23 Phage_terminase
Other DBs
NCBI-ProteinID: ADX49566
Position
complement(968567..969115)
AA seq 182 aa
MYKKERNRPFETREEVLAYHKREKIPCLECGKLLIFLPRHIWFVHGIRADEYRVKWNIPK
HIALAGISYLEKQSEYMKARIAKGKLDPAEQIAMMRIKGRQLKSDPDWRNRSGSILKKQY
ARRDILKNRVWERSPSIKSVSVELKTEAIRRMKNRKVVGEKVQDIADDLNVSISRLYHWL
KM
NT seq 549 nt   +upstreamnt  +downstreamnt
gtgtacaaaaaagagaggaacaggccattcgaaacgcgtgaagaggttctggcatatcat
aagcgggaaaaaataccctgtctggagtgtggcaagttgctcatttttttaccgcgccat
atctggtttgtgcatggaatacgcgctgacgaatatcgtgtaaaatggaacataccgaag
cacatcgcactggcagggatttcatatctggagaaacaaagtgaatatatgaaggcgaga
atagcaaagggaaagctggatcccgcagaacaaatagccatgatgagaataaagggaagg
caactaaagtcagatcctgactggcgtaatcgctccggttctatattgaagaaacaatat
gcccgacgagatatccttaaaaacagggtatgggaaagatctcccagcataaaaagtgtc
tctgtggagttgaaaacagaagctataaggcgaatgaaaaacaggaaggtcgtcggggaa
aaagtccaggatattgccgatgacctgaacgtatctatcagcagattgtatcactggcta
aagatgtag

DBGET integrated database retrieval system