KEGG   Escherichia coli KO11FL: EKO11_0927
Entry
EKO11_0927        CDS       T01718                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_0927
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_0927
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ADX49568
Position
complement(970556..970984)
AA seq 142 aa
MSTPSLYEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLS
LIHQGMVAGIHGLMRQIEETLLRYEPRLSQIQVELLPQPRPGYLNYLIHAQLPDTGWIRF
DGVFSPEGRIVLRHLKQQERAY
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtcgacaccttccttatatgaaatgctgacgttcagtttcagcggcgagttaccactg
gaacaggtcagcgagcgggatcagcttatcctttccgtgatggacaatatgcaacgcatt
atcaactgtcgggcaggcacactggcgcatttgccggattacggtctgccggatctcagt
ctgatccatcagggtatggttgcgggtattcatggcctgatgcgtcagattgaagaaacg
ctgctgcgttatgaaccacgcctgagtcagatacaggtggagttactcccccagccccgt
ccggggtatcttaattacctgatccacgcgcagcttcccgataccggctggatacgcttt
gatggcgtgttttctccggaaggacgaattgttctgcgtcatctcaaacagcaggagcgg
gcgtactga

DBGET integrated database retrieval system