KEGG   Escherichia coli KO11FL: EKO11_0929
Entry
EKO11_0929        CDS       T01718                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_0929
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_0929
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADX49570
Position
complement(971505..972584)
AA seq 359 aa
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQNAPLGSTDNPATDAVRFRPHPGM
GFPVSELKNVERDAGNPDVPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLD
IFNHRFITQYYRIWRKYNYPASFEAGAMDDISRCLLGLIGLGIPGSENHIATPVSRFLAL
LSVMRLPTRTAEGVTALVGLLAPLTKATVVPHDPQPVILPAPAGLSKNSRISLKTRTLLG
RTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLRVYLGWRCQARLQLTLPVSLL
PAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPALSIRNRESMTHVSYSF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggacagagcatcacagccagcgcgtaccgggctgaccgaccggctggccccggatatt
gcgcggatcaatttttaccgtttttgccagttgctggaacagagccagcagaacgcgccg
ctgggcagtaccgacaaccccgccaccgatgcggtgcgctttcgtccccatcccggaatg
ggctttccggtcagcgagttaaagaacgttgaacgtgacgcgggcaatcccgacgtgcca
cccacggtgcgcaccacctttctcggcctgtacggcgtggattcgccgctgccaaccgcc
tatctggactacattacccagcgtcatgacggacatgacgcagtgatggcgtttctcgat
atttttaaccatcgctttatcacccagtattaccgcatctggcgcaaatataactacccg
gcgtcgtttgaagcaggtgctatggatgacatttcccgttgtctgctgggactcatcggg
ctgggtattcccggcagcgagaaccatatcgccacgccggtatcccgttttctggccctg
ctcagcgtgatgcgcctgccgacgcgcacggcggaaggcgtcacggcactggtgggactg
cttgccccgctgacgaaagcgacggtggtgcctcacgatccgcagcctgttattctcccg
gcccctgcgggtctgtcaaaaaattcacgcatcagcctgaaaacgcgaacgctgctgggg
cgtaccggcaccgacgtcaacagccagttgctgctgaaactgtataccgaagatgccgca
gaagcacgtggctggctacctggcgggcagctgcacagcgatttgctggtgctgctgcgc
gtttatctgggctggcgctgtcaggcccgtctgcaactgacgctgcccgtcagcctgttg
cctgctgcccggctgggaaaacagcgcgtacagattagccgtaccggcatccttcgcgcc
tcctttgccgcgcccgcgaccggaacagtgacggtcagtctggggcgttatcagggatta
atacccgctttatccattcgtaacagggagagtatgactcatgtttcctattcgttttaa

DBGET integrated database retrieval system