KEGG   Escherichia coli KO11FL: EKO11_0931
Entry
EKO11_0931        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Other DBs
NCBI-ProteinID: ADX49572
Position
complement(974868..975290)
AA seq 140 aa
MTRVVIALLFLAGCTSQMKYSNVVRIRNVCSSDINVFIPEYVFGGNVIKQHHIYLPVNGI
DVLSYFYTENINDGFQYEEAFTVNKDSSGNFDYPFVILSSGREKKFGKNDLIELSRDIST
KDDKKHGVVKYMIDSQDICP
NT seq 423 nt   +upstreamnt  +downstreamnt
atgactagagtagttattgctttattatttcttgccggatgtacttcgcaaatgaagtat
tccaatgtcgtcaggattaggaatgtatgttcctcagatattaatgtgtttattcctgag
tatgtttttggaggtaatgttattaagcaacatcatatttacttacctgttaatgggatt
gatgttttgtcttatttttatactgaaaacatcaatgatggtttccaatatgaagaagca
ttcaccgtaaataaagatagctcgggtaattttgattatccgtttgttatcttatcatca
ggacgtgaaaaaaaatttgggaaaaacgatctaattgaattgtccagggacatttcaaca
aaagacgataagaagcatggggttgtaaagtacatgatagatagtcaggatatttgccca
tag

DBGET integrated database retrieval system