KEGG   Escherichia coli KO11FL: EKO11_0933
Entry
EKO11_0933        CDS       T01718                                 

Definition
(GenBank) transposase IS3/IS911 family protein
  KO
K07483  transposase
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    EKO11_0933
SSDB
Motif
Pfam: HTH_Tnp_1 HTH_28 HTH_23 TSC22 Abhydrolase_9 Sigma70_r4_2 HTH_29 Exonuc_VII_S DUF4140 Surfac_D-trimer DivIC
Other DBs
NCBI-ProteinID: ADX49573
Position
976316..976627
AA seq 103 aa
MNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGITPSA
TPITPDQQRIRELEKQVRRLEEQNTILKKATALLMSDSLNGSR
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaacaagaaaaccaaacgaaccttcacccctgagttcaggctggaatgtgcacagctg
attgttgataagggctactcatatcgacaggccagtgaagcgatgaatgtcggttcaacc
acgcttgagagctgggtacgccagctcaggcgagagcgccagggtattacgccctctgcc
acacccattactccagaccagcaacgtatccgcgagctggaaaagcaagttcgccgtctg
gaggaacaaaatacgatattaaaaaaggctaccgcgctcttaatgtccgactcgctgaac
ggttcacgatag

DBGET integrated database retrieval system