KEGG   Escherichia coli KO11FL: EKO11_0937
Entry
EKO11_0937        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Other DBs
NCBI-ProteinID: ADX49575
Position
complement(979871..979978)
AA seq 35 aa
MWAKHMLIKGKEVMEHEVKEYLKDKLNNVSKWELK
NT seq 108 nt   +upstreamnt  +downstreamnt
atgtgggcaaaacacatgcttattaaagggaaggaagtaatggaacatgaagtgaaggag
tatttaaaagataaactaaacaatgtgagcaaatgggaattgaaatag

DBGET integrated database retrieval system