KEGG   Escherichia coli KO11FL: EKO11_0938
Entry
EKO11_0938        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: ADX49576
Position
complement(980428..981345)
AA seq 305 aa
MGRGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDI
HGRLMAGTLDSQSSCPCKARFIASMMDDTYETKEGSGTDNQIAGIDQNRLNKEWTDVRGD
NTQKKTKYTSEIILITSTIRVYSTNAEVMGDHSAIYFEVSGDSSSPYLYDPNGSYNPYKK
LENGNGQRGSGFVFSGEFAKLDDFISYQENPNEVTQNKLDSEWFPYKVKLLSLPVTNDEL
LTIKNAALALDDGDEEPGSFSCAEWSSKLLKYIIPELDIYTLPNSLWEAVVKEKEKRIKL
NGENK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgggaagaggctattttctggtcaggggcgataagaccacctgcggcgggaagattatt
gaaggcgcggacgaccatacgatcatgggtatcccacaggcacgggatatggaccgggtc
acctgcggcagatatccgggaatgtttattattgtgggcggcgttcctgaaacagatatt
cacggcaggctgatggcggggacgctggacagtcagagcagttgcccgtgtaaggcgcga
tttattgcgtcaatgatggatgatacgtatgagaccaaagaaggttcaggaacagataac
cagatagcaggaatagatcagaataggttaaataaagaatggacggatgttcgaggagat
aacactcagaaaaaaacaaaatatacatcagaaataattttaattacatccacaattaga
gtatatagtactaatgccgaggtaatgggagatcattcagctatttattttgaagtgtct
ggtgattcatcaagcccttatctttatgatcctaatggaagctataatccttataaaaaa
ttagaaaatggaaatgggcagagaggatccggttttgtatttagtggtgaatttgcaaaa
ctggatgattttatcagttatcaagaaaatccgaatgaagtaacgcagaacaagctggat
agcgaatggtttccctataaggtaaagttattatctttaccggtaacgaatgacgagtta
ttaacgataaagaatgctgcattggcattagatgatggcgatgaagaaccggggagtttt
agttgtgccgaatggtcttcaaaattgttaaaatatataatcccagaacttgatatttat
acgctgccaaattcactatgggaagcggttgttaaagaaaaagaaaaaagaataaagtta
aatggcgagaataaatga

DBGET integrated database retrieval system