KEGG   Escherichia coli KO11FL: EKO11_0941
Entry
EKO11_0941        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Other DBs
NCBI-ProteinID: ADX49579
Position
complement(986343..987557)
AA seq 404 aa
MPVRLNTIPDAESYPAPPARIKWLSALLLMLSVGVAITSLFASDELAKNGPHFWGLACGV
PAFIWSLVASVRWLFFITQYIRADAWNKRREEVILQETRRGRRALQILSFSVQTALNGDS
VAETTTAFLARQQVLNTYADLRGEDTVRRSVIPVLTNKPVTGRLSEIISRLFIDIRPQLF
LLPPDFHINVLLEIDAPLSGASVRTIWQDEWQKAGLPEARLFSAPEPGLAAVDDWLDNFI
QEKAVLLVISVRLEPKNPERTAESATALLLANRLTQTALTPLALLHRPERITDTEMMASG
IAQALDWMPVQPDAISGIWTAELDREQRTALLSLNQPFTQEALMYELDAFLGRSGPAAPW
LSVAAATLAAIQSQHPQLTLSGVQGGHYSWATVVSPFVSPQEAS
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcctgtccgacttaataccattcccgacgcagaatcctatcccgcaccgccagcccgc
attaaatggctgtcagccttattactgatgctgtctgttggtgtggcaataacctcatta
ttcgccagcgatgaactggcaaaaaacggcccgcatttctgggggctggcctgcggtgtg
cctgcctttatctggtcgctggttgcttcagttcgctggttgttttttatcacgcagtac
attcgggctgatgcctggaataagcgccgggaagaggtgattttgcaggaaacgcgacgg
ggacgacgggcgttgcagatacttagtttttccgtacaaaccgcgctgaatggtgattcc
gttgcagaaactacaacagcatttctggcgcgtcagcaggtgttgaatacttacgctgat
ttgcgcggagaagatactgtgcgtcgcagtgtcattcccgtattaaccaataaaccggtt
accgggcgtttatccgaaattatttcccgcctttttattgatatcagaccgcaattgttt
ctgctgccccctgattttcatatcaacgtactactggaaattgatgcgccgctttcaggg
gcctccgtgagaactatctggcaggacgaatggcaaaaagccggactcccggaagcccgt
ctgttttctgccccggagccggggctggccgccgtggacgactggctggacaactttatt
caggaaaaggccgtactgctggtgatttccgtgcgtctggaaccgaagaacccggaacgg
acggcagaatccgccaccgcgctgttgctggcaaaccggttgacgcaaaccgcgctgacg
ccgctggccctgctgcatcgtcctgaacgtatcacagatacagagatgatggcgtcaggc
attgcacaggcgctggactggatgccggtgcagccagatgccatatccggcatatggact
gccgaactggacagggaacagcgtaccgcgttgttatcccttaaccagccgtttactcag
gaagccctgatgtacgagctggatgcctttctggggcgctccggaccggcagcgccgtgg
ctgtccgtcgctgcggcaacgctggcggcaatacaatcacaacacccccaactaacgctc
agcggcgttcagggcgggcattattcatgggcgaccgtggtgtcgccattcgtttcccca
caggaggcatcatag

DBGET integrated database retrieval system