KEGG   Escherichia coli KO11FL: EKO11_0942
Entry
EKO11_0942        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Other DBs
NCBI-ProteinID: ADX49580
Position
complement(987635..988117)
AA seq 160 aa
MKTCQLKKNESVQLLSLRTIDGDTLYLKFRNVITGAFLDTPTKSYDFFGDVVLSQCINGS
LIFALEYGSPYIKGCLVTGWENGFKGKNSPEGFCFAERNIPEAVWFGKNNILIIIRNQMD
VGTWKGKYIIYDNAKKSGERAYSSDNLPSKDGYIIFALNK
NT seq 483 nt   +upstreamnt  +downstreamnt
gtgaaaacctgtcaactgaaaaaaaatgaaagtgtgcagttgctttcccttagaaccatt
gacggtgatacattatatctaaaattcagaaatgttatcaccggggcctttttagatact
ccaactaaaagttatgatttttttggagatgtggttctttctcagtgcataaatggttct
cttatctttgcgctggaatatggttctccatatataaaaggttgtctggtaactggttgg
gaaaatgggtttaaaggtaagaactctcctgaaggcttttgtttcgcagagagaaatatt
cccgaagcggtatggtttggaaaaaacaatattttaattatcatccgaaaccaaatggat
gttgggacatggaaagggaaatatattatctatgataatgcgaaaaagtcaggagaaaga
gcatactcatcagataatctaccatcaaaagatggttacataatttttgcattaaataaa
taa

DBGET integrated database retrieval system