KEGG   Escherichia coli KO11FL: EKO11_0944Help
Entry
EKO11_0944        CDS       T01718                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eko  Escherichia coli KO11FL
Pathway
eko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EKO11_0944
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_0944
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Laminin_II Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: ADX49581
Structure
PDB: 

Position
complement(988810..991317)
Genome map
AA seq 835 aa AA seqDB search
MDILVFDHSYHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDG
AFSLTAPPVQGMPVQAPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIY
QNQTVPQIVEKILRERHQMRGQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWF
RFATDARLKIEVIEFYDDQSGYERGLTLPLRHPSGLHDGATEAVWGLNTAYRVVEKSVST
RDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQKGDNEAAESGAFYARIRHERY
LNEQAILKGLSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDRSYELTFTAIP
YSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKR
NVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGA
VRAKKGIFISADAQDKAQGQVREMAPAMAILDGAQSQMQSLSTDAQTTNADPADLSSQIA
LLQQSVKDLTQAVILLSAPKGVAIASGEHLQLAASKNVIANAGNNADIGVVKNMFIGVGQ
ALSVFVRKAGIKLFANKGAVSVQAQNDLMELLAQKSIEITSTEDEIKITAKKKITLNGGG
SYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDFNQSFILLDENTG
QPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDDIN
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggacatacttgtttttgaccactcgtaccacaaactcaaaatccgcggcctgcaaagt
ccggtggatgtgctgaccttcgaaggccgcgaacaactgagtaccccgttccgctacgac
attcagtttaccagtaccgataaagccatcacgccggagttggtgctgatgcaggacggc
gcattcagcctgacggcaccgccggtacagggaatgccggtgcaggcacccctgcgcacc
ctgtacggcgtcatcaccggctttaaacatctctcatcgtcacaggacgaagcccgttac
gaagtacggcttgaaccccgtatggcgctgctgacccgcagccgccagaatgccatttac
cagaaccagactgtgccgcaaatcgtcgaaaaaatcctgcgcgagcggcaccagatgcgc
ggtcaggacttcgtgtttaacctcaaaagcgaatacccggcccgcgaacaggtgatgcag
tatggcgaggacgacctgacgtttgtctcgcgcctgctgtcagaagtgggtatctggttc
cgcttcgccaccgatgcccggctgaaaattgaggttatcgagttttacgacgaccagagc
ggctatgagcgcggactgacgctgccgcttcgccatccttcagggttacacgacggcgcc
acggaagcggtatggggactgaacaccgcgtacagggtggtggaaaaaagcgtctccacg
cgggactacaactaccgcaccgccacagcggagatgatgacagagcagcatgacgccacc
gggggcgataacaccacctacggcgaagcctaccactatgctgacaacttcctgcaaaaa
ggcgataacgaggcagcggaaagcggcgcgttttacgcccgtatccgccacgaacgctac
ctgaatgaacaggccattctcaaaggcctgagcaccagttcactgctgatgccggggctg
gaaatcagggttcagggcgacgacgcgcctgcggtattccgcaagggcgtgctgattacc
ggcgtgacggccagcgcggcgcgtgaccgcagctatgaactgacgttcacggccataccc
tactcagaacgctacggctaccgcccggcgcttatcccccgcccggtaatggccggcacg
ctcccggcgcgggtcaccagcacagtgaagaacgatatttatgctcatatcgacaaggac
gggcgctaccgggtcaacctcgactttgaccgcgatacgtggaaaccgggttatgaaagc
ctgtgggtacgccagtcgcgcccgtatgcgggagacacctacggcctgcatctgccgctg
ctggcgggaacggaagtcagcatcgcgtttgaggaaggcaacccggaccgaccttatatc
gcaggcgtaaaacacgactcggcgcacaccgaccatgtgaccatccagaactacaagcgc
aacgtgctgcgtaccccggcgaacaacaaaatccgcctcgatgatgagcgcggcaaagag
catatcaaggtcagtaccgagtacggcggcaagagccagttgaatctgggtcatctggtg
gatgccggaaaacaacagcgcggggaaggctttgaactgcgtaccgatatgtggggcgcg
gtgcgggcgaagaaagggatttttatcagcgccgatgcgcaggataaggcgcaggggcag
gtgcgcgaaatggctccggcgatggcaatactggatggcgcacagtcacagatgcagtcg
ctgtccactgatgcgcagacgacgaatgccgatccggcagatctgtcatcgcagatagcg
ctgttgcagcaaagtgtaaaagatctgacgcaggccgtgatcctgctaagtgcacccaag
ggcgtggcgatcgccagcggcgagcacctgcaactggcggcgtcgaagaatgtgatagcg
aacgcaggcaacaacgcagatatcggcgtagtaaaaaatatgtttatcggtgtgggtcag
gcgctgagcgtgtttgtgcgtaaagcgggcatcaagctgtttgccaataaaggggcggtc
tcggtacaggcacagaacgatctgatggaactgttggcacagaaatcgatagagatcacc
agtacggaagatgagatcaagatcaccgcgaagaagaaaatcacccttaacggcggtggc
agctacatccggctggatgcctgcgggatagaagcgggaacgccgggagaatataacgtt
aaggccggatattacgggcgtaaaccaaaggcgaagctgacgccggagctgatggcattt
ccggtgattaagtctgaggattttaatcagagctttattttgctggatgaaaatactggg
caaccacttattaattggccctatgaactagaactggaaagtgggctaaaaatgagtggg
attactgatgaaaatggaaatacagaactaatatcctctgataaggaggaggtcgttaat
attagtgtgtttgaacccgatgagtttttagacgatgacattaattaa

DBGET integrated database retrieval system