KEGG   Escherichia coli KO11FL: EKO11_0947
Entry
EKO11_0947        CDS       T01718                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eko  Escherichia coli KO11FL
Pathway
eko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EKO11_0947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_0947
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_0947
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: ADX49584
Position
complement(993021..995507)
AA seq 828 aa
MGIQNFDHSHHKLKIRGQQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDG
AFSLTAPPVQGMPVQAPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLARSRQNAIY
QNLTVPQIVEKILRERHQMRGQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWF
RFATDARLKIEVIEFYDDQSGYERGLTLPLRHPSGLHDGATEAVWGLNTAYRVVEKSVST
RDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQKGDNEAAESGAFYARIRHERY
LNEQAILKGLSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDRSYELTFTAIP
YSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKR
NVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGA
VRAKKGIFISADAQDKAQGQVREMADIISELNGLSDKIQKLSDDATMANADPADMAAQIA
LITSRINDLTAPVILMHAPKGVAVASGEHLQLAAVKNLQINAGNNADIGVVKNMFIGVGR
ALSVFVRKAGIKLIANKGAVSVQAQHDLMELLAKKSIEIVSTEDEIRISAKKKITINGGG
SYIRIEGSGIEPGTPGDYNVKAVHYGRQPGAKLKQEMMAFPMIESGEFNTRFFFTDDNDI
PYANTKYIARLPDGTTKDGITSDDGRSEIFFSDKDGEILIHLFVEQDK
NT seq 2487 nt   +upstreamnt  +downstreamnt
atgggtattcagaatttcgaccactcgcaccacaagctcaaaattcgcggccagcaaagt
ccggtggatgtgctgacctttgaaggccgcgagcaactgagtaccccgttccgctacgat
atccagtttaccagtaccgataaagccatcacgccggagttggtgctgatgcaggacggc
gcattcagcctgacggcaccgccggtacagggaatgccggtgcaggcccccctgcgcacc
ctgtacggggtcattaccggttttaaacatctctcatcgtcacaggacgaagcccgttac
gaagtacggctggagccgcgtatggcgctgctggcccgcagccgccagaatgccatctac
cagaatctgacggtgccgcaaatcgtcgaaaaaatcctgcgcgagcggcaccagatgcgc
ggtcaggacttcgtgtttaacctcaaaagcgaatacccggcccgcgaacaggtgatgcag
tatggcgaggacgacctgacgtttgtctcgcgcctgctgtcagaagtgggtatctggttc
cgcttcgccaccgatgcccggctgaaaattgaggttatcgagttttacgacgaccagagc
ggctatgagcgcggactgacgctgccgcttcgccatccttcagggttacacgacggcgcc
acggaagcggtatggggactgaacaccgcgtacagggtggtggaaaaaagcgtctccacg
cgggactacaactaccgcaccgccacagcggagatgatgacagagcagcatgacgccacc
gggggcgataacaccacctacggcgaagcctaccactatgctgacaacttcctgcaaaaa
ggcgataacgaggcagcggaaagcggcgcgttttacgcccgtatccgccacgaacgctac
ctgaatgaacaggccattctcaaaggcctgagcaccagttcactgctgatgccggggctg
gaaatcagggttcagggcgacgacgcgcctgcggtattccgcaagggcgtgctgattacc
ggcgtgacggccagcgcggcgcgtgaccgcagctatgaactgacgttcacggccataccc
tactcagaacgctacggctaccgcccggcgcttatcccccgcccggtaatggccggcacg
ctcccggcgcgggtcaccagcacagtgaagaacgatatttatgctcatatcgacaaggac
gggcgctaccgggtcaacctcgactttgaccgcgatacgtggaaaccgggttatgaaagc
ctgtgggtacgccagtcgcgcccgtatgccggtgacacctacggcctgcatctgccgctg
ctggcgggaacggaagtcagcatcgcctttgaggaaggcaacccggaccgaccttatatt
gcaggcgtaaaacacgactcggcacacactgaccatgtgaccatccagaactacaagcgc
aacgttctgcgcacccctgccaataacaaaatccggctggatgatgagcgcggtaaagag
catatcaaggtcagtaccgaatatggcggcaagagccagctaaacctcggtcatcttgtt
gatgccgggaaacagcagcgcggggaaggctttgaactgcgtaccgatatgtggggtgcg
gtgcgggcaaagaaaggcatctttatcagcgccgatgcgcaggataaggcgcagggtcag
gtcagagagatggccgacattatcagcgaactgaacggcctgagcgataaaatccagaaa
ctgtccgatgacgcgacgatggcgaacgccgacccggcggatatggccgcgcagatagca
ttgataaccagccggataaacgacctgaccgccccggtgattttgatgcacgcgccgaaa
ggtgtggcggtcgccagcggcgagcacctgcaactggcagcggtgaaaaacctccagata
aatgcgggaaacaacgccgatatcggcgtggtgaagaatatgtttatcggcgtggggcgg
gcgctgagcgtgtttgtgcgcaaggcgggtatcaaactgattgccaataaaggcgcagta
tcggtacaggcgcagcacgatttgatggagttactggcgaagaagtcgatagagatcgtc
agtaccgaagatgagatcaggatttcagcgaagaaaaaaataacgattaatggcggtgga
agttatatccggattgagggtagcggcattgagccaggaacgccgggggattataacgtc
aaagcggtgcattatgggcgtcagccgggagcgaagctgaaacaggaaatgatggcgttt
ccgatgattgaatctggagaatttaatacccgtttcttttttacagatgataatgatatt
ccttatgcaaacaccaaatatatagcaagattaccagatggtacaacaaaagacggcatt
acaagcgatgatggtcgatcagaaatatttttttctgataaggatggggaaatattaata
catctatttgtcgagcaggataaataa

DBGET integrated database retrieval system