KEGG   Escherichia coli KO11FL: EKO11_0948
Entry
EKO11_0948        CDS       T01718                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
eko  Escherichia coli KO11FL
Pathway
eko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EKO11_0948
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_0948
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_0948
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Clp_N AAA_25 AAA_22 NACHT ATPase_2 AAA_7 Sigma54_activat IstB_IS21 AAA_24 DUF815 RsgA_GTPase CxC7
Other DBs
NCBI-ProteinID: ADX49585
Position
complement(995519..998164)
AA seq 881 aa
MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRY
EWDIDTLWQSLLAHLDTLPRSVRERPQLSEPLTALIRQAWLIASLEGDDPQIRSQHLLMA
LTEKPMLPACNDLWVLLSLSRVQLERLRPLLDAQSDECPARQPQVTEPLTSAQPEAATTD
APAKTLTGKQDDALLAVLNRFTEDVTEKARSGRIDPVFGRDTEIRQMVDILSRRRKNNPI
LVGEPGVGKTALVEGLALRIAEGNVPDSLKTVHIRTLDLGLLQAGAGVKGEFEQRLKNVI
DAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYF
ERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAQHHGVHMLDSAIQTAVRLSRRYLTG
RQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLQARLTALDIEREAIEQDSVFYPEASPER
LAELTDLRDELQAEAGHLEAQYQQEKALAQQIMTLRQEGTDSTELQQQLRAHQGFAPLLA
LDVDARAVATVVADWTGIPLSSLLKDEQSDLLSMEQSLENRVVGQSPALCAIAQRLRAAK
TGLTPENGPQGVFLLTGPSGTVKTETALTLADTLFGGEKSLITINLSEYQEPHTVSQLKG
SPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVMNLFYQVFDRGFMRDGEGREID
FRNTVILMTANLGSDHIMQLLEEKPDATDADLHELLYPLLREHFQPALMARFQTVIYRPL
GQEAMRAIVEMKLAQVVRRLRQHYGLETEINDSLYDALTAACLLPDTGARNIDSLLNQQI
LPVLSQQLLAQQAAHHKPAQLRLGWDEEDGIVLEFATEEMQ
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgaccggaaatcaccccgccgcgctgctgcgtcgccttaacccgtactgtgcacgggcg
ctggacgctgccgcctcactgtgtcagacccgcgcccatgcggagataaccattgaacac
tggctgctgaaactgctggagcagggagaaggcgatatcacggtgattgcccgccgctat
gaatgggatatcgacacgctctggcagtctctgctggcacatctggacaccttaccccgc
tcggtccgcgaacgtccgcagctttctgaacccctgacggcgcttatcaggcaggcgtgg
ctgattgcctcgctggaaggcgacgacccgcaaatccgcagtcagcacctgctgatggcg
ctgacagaaaaaccgatgctgcccgcctgtaatgacctgtgggtattgctgagcctgagc
cgtgtgcagcttgagcggctgcgtcccctgctggatgcgcagtcggatgaatgtccggca
cgtcagccacaggtcaccgaaccgctgacatccgcgcaaccagaggcggcaacgacggac
gcaccggcaaaaacgctgacggggaaacaggatgacgccctgctggcggtgcttaaccgc
tttaccgaagacgtgacggaaaaagcccgcagcgggcgaatcgacccggtattcgggcgc
gacacggaaattcgccagatggtcgatatcctctcacgtcgccgcaaaaacaacccgatt
ctggtgggagaaccgggggtgggcaaaaccgcgctggtggaagggctggcgctgcgtatc
gccgaaggcaacgtgccggacagcctgaaaacggtgcatatccgcacactggacctcggt
ctgttacaggctggcgcgggtgttaaaggtgaatttgaacagcggctgaaaaatgtcatc
gatgcagtgcagaaatcaccggagccggtactgctgtttattgatgaagcccataccatt
atcggtgcgggtaatcaggcaggcggcgcggatgcggcgaacctgctgaaaccggcgctg
gcaaggggcgaactgcgcaccatcgccgccacaacgtggagcgaatacaaacagtatttt
gagcgcgacgccgcgctggaacgccgcttccagatggtgaaagtcgacgagccggatgat
gacaccgcctgcctgatgctgcggggactcaaggcccgctatgcacagcaccacggcgta
catatgctggacagcgccattcagaccgccgtgcgcctgtcgcgccgctatctgaccgga
cgccagttgccggacaaggcggttgatttgctggataccgccggggcaagagtccgcatg
agcctcgacaccctgccggaaccgttgacgcagcttcaggcgcgtctgaccgcgctggat
attgagcgggaagcaattgagcaggacagcgtgttttatcccgaagccagcccggagcgg
ctggcggaactgaccgatttgcgtgatgagctgcaggcagaagccgggcatctggaagcg
cagtatcagcaggaaaaggcactggcgcagcagattatgacgttgcgtcaggaagggaca
gacagcactgaactgcaacagcaactgcgagcgcatcagggctttgctccgttgctggcg
ctggatgtggacgcccgcgccgtcgccacggtggtggcggactggaccggcatcccgctc
tcttcgctgctcaaggacgagcagagcgacctgctcagtatggaacaaagccttgaaaac
cgcgttgtcgggcaaagcccggcgctctgcgccatcgcacagcggctgcgggcggctaaa
accggcctcacgccggagaatggcccgcagggggtattcctgctgaccggccccagcggc
accgttaaaaccgaaactgcgctcacactggccgacaccctgtttggcggtgaaaaatcc
cttatcaccatcaacctctccgaatatcaggagccgcataccgtctcccagcttaagggg
tctcctccgggctacgttggctacggtcagggcggcgtacttaccgaagccgttcgcaaa
cgcccgtacagcgtggtgctgctcgacgaagtggaaaaggcgcaccgcgacgtaatgaac
ctgttctatcaggtgtttgaccggggttttatgcgcgacggcgaagggcgggaaattgac
ttccgcaacaccgtgattctgatgacggctaatctgggcagcgaccacatcatgcagctg
ctggaggaaaaaccggacgccacagacgcagacctgcatgaactgctgtatcccctgctg
cgcgagcacttccagcctgcactgatggcgcgttttcagacggtgatttaccgcccgctg
ggacaggaagcgatgcgcgccattgtggaaatgaaactggcgcaggtggttcgtcgtctt
cgtcagcactatgggctggaaacggaaatcaacgacagcctgtacgacgccctgaccgcc
gcctgcctgctgccggacaccggtgcgcgtaatatcgacagcctgctgaaccagcaaatc
ctgccggtcttaagccagcagttgctggcacagcaggctgcgcaccataagccagcccaa
ctacggcttggctgggatgaggaagacgggattgtactggagttcgctacggaagagatg
caataa

DBGET integrated database retrieval system