KEGG   Escherichia coli KO11FL: EKO11_0949
Entry
EKO11_0949        CDS       T01718                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eko  Escherichia coli KO11FL
Pathway
eko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EKO11_0949
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_0949
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_0949
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADX49586
Position
complement(998355..998846)
AA seq 163 aa
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFT
FTKEIDASSPYLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHD
IKEPSKEKHNHLERIEFRYEKITWTYKDGNIIHSDSWNERPSA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggctattcctgcttatctctggctgaaagatgacggcggcgcggatatcaaaggttcc
gtggacgttcaggggcgcgaaggcagcatcgaagtggtggcgctggatcacgatgtgtac
atcccgaccgacaacaacaccggcaaactgaccggtacccgtactcacaagccctttacg
tttaccaaagaaatcgatgcgtccagcccgtatctctacaaagcagtcaccaccggccag
accctgaaaacggcggaatttaagttttaccgcatcaacgatgccggtcaggaagtggag
tacttcaacatcacgctggataacgtcaagctggtcagagtcgctccgctgatgcacgac
atcaaggagccttccaaagagaagcataaccacctggaacgcattgagttccgctacgag
aaaatcacctggacttacaaagacggcaacatcattcattccgactcgtggaatgaacgt
ccttccgcctga

DBGET integrated database retrieval system