KEGG   Escherichia coli KO11FL: EKO11_0950
Entry
EKO11_0950        CDS       T01718                                 

Definition
(GenBank) OmpA/MotB domain protein
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: ADX49587
Position
complement(998904..1000556)
AA seq 550 aa
MRNTLKQAVVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTG
DAGLSSLPPETYRQPVVLVCGDMSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTL
RPAWASQLAVAYTVMPGMYRDAAVLTGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPL
PEKAHSPWLICTGGEIQVATSAETASPAQWLTQTSTQERSQPLCYLLKAESLMQWLNLYV
LAALNGPEAKCPPLAMAVGLHPSLPAVDNNLWQLWITARTGLTTDIADTGTDATLPFPDA
LLRRLPRQSGFTPLRRASVTMLGITTVAGIAALCLSATANHQLLRHIGDDLHQFYAVPAE
EFITKARRLSVLKDDAVMLDGYYREGEPLRLGLGLYPGEQIRQPVLRAIRDWRPPEQKME
VTASLQAQTVRLDSMSLFDVGQARLKDGSTKVLVDTLVNIRAKPGWLILVAGYTDATGDE
KSNQQLSLRRAEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLV
PRSDACQDVK
NT seq 1653 nt   +upstreamnt  +downstreamnt
gtgaggaacacgctgaaacaggccgtcgtgctgtggggaatggtgttactgctggtgctg
tggtcggtgtttatcagtccgtctggcgtactgagatgggccggggcggcggctatcgtt
ctggcggttgccgcgttgctgatttaccggcgcaggcaggcgtggacggagatgaccggc
gatgccgggttgtcatcgctgccgccggaaacgtaccgacaaccggtagtgctggtctgt
ggcgatatgtcggcgcatctgttcactgacagcccggtccggcaggtttcagaagggctg
tatctgcatgttcccgatgaagaacagcttgtggcgcaggtggagcgattactgaccctt
cgcccggcgtgggcatcgcagcttgccgtggcgtataccgtcatgcccggcatgtaccgg
gatgcggcggttctgaccggacgactgcgacggttcgcccacagtatggcgacagtgcgt
cgccgggcgggcgtaaacgtcccctggcttctctggagcgggctgtccggctcgcccttg
ccggagaaggcacattcaccgtggcttatctgtaccggcggcgaaattcaggtagcgacg
tctgctgaaaccgcctcccccgcgcagtggctcacgcagaccagcacacaggagcgcagc
cagccactctgttacctgctgaaagccgaaagcctgatgcagtggctgaatctttatgtg
ctggcggcactgaacggcccggaggcgaaatgcccgccactggcgatggccgtggggcta
cacccctcgttgcctgcagtggataacaacctgtggcagctgtggatcaccgccagaacc
ggcctgacgacggatatcgcggacaccggcacagacgccacgctgccgtttccggatgcc
ctgttacggcggttgccgcgtcagtcgggctttaccccgctgcgacgggccagtgtaacc
atgctgggcatcaccaccgtggcgggtatcgccgcgctgtgtctgtcagccacggcgaat
caccagttattacggcatatcggtgacgatctgcaccagttttatgccgttccggcggag
gaatttatcaccaaagcccgtcgtctgtcggtgctgaaagacgatgcggtcatgctcgat
gggtattaccgggaaggagaaccgctgcgtctcggtctggggttataccccggcgaacaa
atccgccagccggtattacgcgccattcgtgactggcgtccgcctgagcaaaaaatggaa
gtgacagcctcgcttcaggcgcagaccgtgcgtcttgacagtatgtcgctgtttgacgtc
ggacaggcccgcctgaaagacggctcgacaaaagtgctggtggacacactggtgaacatc
cgggcaaaaccgggctggcttatcctcgtggccggatataccgacgccaccggcgacgaa
aaaagcaatcagcagttatcactgcgacgtgccgaagcggtgcgtaactggatgctgcag
accagcgacatcccggccacctgttttgccgtacagggactgggtgagagccagcctgcg
gcgaccaacgatacgccacagggccgggcagtcaaccggcgcgtcgaaatcagtcttgtt
ccgcgttctgacgcctgtcaggacgtgaaataa

DBGET integrated database retrieval system