KEGG   Escherichia coli KO11FL: EKO11_0952
Entry
EKO11_0952        CDS       T01718                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_0952
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_0952
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ADX49589
Position
complement(1001231..1002568)
AA seq 445 aa
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALMSGKLK
TQAVRLRFADGTLIDSDVSDVLPLACDLHALTNDSAVVLLALPLAHGNGGNLGQGEQTER
PLRYRQEWQKVQDIYGSDSEDMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQD
ESYIPPLLAFNAHDGLVQRLDTLLLQLRAKCQRLMAMRRESNQRMADFAVADVSLFWLLN
ALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLEHNVSAVPPYVHESPSTVFPP
LFSLLSELLEASLPSRVIALELGSLPGNRWKADLHDPRLREEADFYLSVRSSLPAHQVLH
QLPLVCKIGAPDDVTLLINVALNGVSLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgaaaattcatcgaccactgtgggctgaggggacattcctgtcctctcagcagtttcag
cagcaggcccgctgggaagcgttcagcaatgacagcattgcgcaactttgtattcgtcat
ccgtgggggatcgcgaatgtgctctttgaccgcgatgccctgatgtccggaaagctgaaa
acgcaggcagtacgcctgcgttttgctgatggcacgctgatcgattctgacgtgagcgat
gttctgcctctcgcctgcgatctgcacgcgctgacgaacgacagcgcggttgttctgctg
gcgctgccgcttgcccatggtaacggcggtaatctcggtcagggtgagcagactgaaaga
ccgctacgctatcgtcaggaatggcaaaaggtacaggatatctacggcagtgacagtgaa
gatatggccgttgagcgtcatgcgctgtccctgcgctttgctcatgataacaatcaggat
tacatcacctgcccactggcgcgtctggtgcgggatgttcagggcaactggacacaggat
gagagttatattccgccgttactggcgtttaacgcccatgacggactggtacagcgtctg
gacacgctgctgttgcagctacgggccaaatgtcagcgcctgatggcgatgcgtcgggaa
agcaaccagcgtatggcggacttcgccgtcgccgatgtctccctgttctggttgcttaac
gcgctgaactccgccgagccggtgctgagtgatttcctgcgctacccggcggttcacccc
gaactggtctggcgggagctggcgaggcttgccggggcgctgctgacattttcccttgaa
cataacgtcagcgccgtcccgccctatgtccacgaatcgccgtccaccgtctttccgccc
ctgttctccctgctcagcgaactgctggaagccagcctgccgtcacgggtgatcgcactg
gagctgggatccctgccgggcaaccgctggaaagcagacctgcacgatccgcgcctgcgg
gaagaggccgatttttatctgtccgttcgttcctctctgcctgcgcatcaggtactgcac
cagctaccgctggtctgcaaaatcggtgcgcctgatgacgtcacgctgcttatcaacgtg
gcgctgaacggtgtttcactggtgccactgacctcagttccggcggcgctgccgctgcga
ctggagaaccagtattttgcgctggatatgcacagtgacgcggctaaatcgatgctggag
tccgggtgctgcatgatttatgcgccaggaaccatgggcgacctgaaacctgaactgttt
gcggtgctgcgcgcatga

DBGET integrated database retrieval system