KEGG   Escherichia coli KO11FL: EKO11_0956
Entry
EKO11_0956        CDS       T01718                                 

Definition
(GenBank) UBA/THIF-type NAD/FAD binding protein
  KO
K22132  tRNA threonylcarbamoyladenosine dehydratase
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eko03016]
    EKO11_0956
Transfer RNA biogenesis [BR:eko03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    EKO11_0956
SSDB
Motif
Pfam: ThiF UDPG_MGDP_dh_N Sacchrp_dh_NADP DAO NAD_binding_7 3HCDH_N ELFV_dehydrog ApbA
Other DBs
NCBI-ProteinID: ADX49592
Structure
PDB: 
4D79 4D7A 4YED 4RDI 4RDH

Position
1006777..1007583
AA seq 268 aa
MSVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLI
DMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSV
GYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAK
LRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSDGTVCAMKATAEGPKRMDCASGFGA
ATMVTATFGFVAVSHALKKMMAKAARQG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtctgtggtaattagtgatgcatggcgtcagcgttttggtggcacagcgcgtctgtat
ggtgaaaaagcgttgcaactgtttgctgacgcgcatatttgtgtggttggtatcggtggt
gtcggttcctgggcagcggaagcgctggcgcgcacggggattggcgcaatcacgcttatc
gatatggatgatgtgtgcgtcaccaataccaatcggcaaattcacgctctgcgcgataac
gtcgggctggcaaaagcggaagtcatggcggagcgtattcgccagattaacccggagtgc
cgtgtaacggtggtggatgatttcgtgacgccggataacgtagcgcagtatatgagcgtg
ggttattcgtacgtgattgatgccattgatagtgtacggcccaaagcggcgctgattgct
tattgtcggcgcaataaaatcccgctggtcacgaccggtggcgcgggtgggcagattgac
ccgacgcagattcaggttaccgatctggcgaaaacgattcaggatccgctggcggcgaag
ttgcgcgagcgcctgaaaagcgattttggcgtagtgaaaaacagtaaaggtaagctcggc
gtcgattgcgtgttttctactgaagcgctggtgtacccgcagtcagacggtactgtgtgt
gcgatgaaagccacggcagaagggccgaagcggatggattgtgcatctggatttggcgcg
gcaacgatggtgaccgccacctttgggtttgttgcggtttctcatgcgctgaagaagatg
atggcgaaagcggcgcgtcagggttaa

DBGET integrated database retrieval system