KEGG   Escherichia coli KO11FL: EKO11_0958
Entry
EKO11_0958        CDS       T01718                                 

Definition
(GenBank) aminotransferase class V
  KO
K01766  cysteine sulfinate desulfinase [EC:4.4.1.-]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EKO11_0958
Enzymes [BR:eko01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.-  
     EKO11_0958
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP SelA
Other DBs
NCBI-ProteinID: ADX49594
Structure
PDB: 

Position
complement(1008077..1009282)
AA seq 401 aa
MNVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATRQFYSLSAGNVHRSQFAEAQR
LTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHH
ANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLA
RAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLE
AMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESW
SRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQ
PLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLVD
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaacgtttttaatcccgcgcagtttcgcgcccagtttcccgcactacaggatgcgggc
gtctatctcgatagcgccgcgaccgcgcttaaacctgaagccgtggttgaagccactcga
cagttttacagcctgagcgccggaaacgtccatcgcagccagtttgccgaagcccaacgc
ctgaccgcgcgttatgaagctgcacgagagaaagtggcgcaattactgaatgcaccggat
gataaaactatcgtctggacgcgcggcaccactgaatccatcaacatggtggcacaatgc
tatgcgcgtccgcgtctgcaaccgggcgatgagattattgtcagcgtggcagaacaccac
gctaacctcgtcccctggctgatggtcgcccaacaaactggagccaaagtggtgaaattg
ccgcttaatgcgcagcgactgccggatgtcgatttgttgccagaactgattactccccgt
agtcggattctggcgttgggtcagatgtcgaacgttactggcggttgcccggatctggcg
cgagcgattacctttgctcattcagccgggatggtggtgatggttgatggtgctcagggg
gcagtgcatttccccgcggatgttcagcaactggatattgatttctatgctttttcaggt
cacaaactgtatggcccgacaggtatcggcgtgctgtatggtaaatcagaactgctggag
gcgatgtcgccctggctgggcggcggcaaaatggttcacgaagtgagttttgacggcttc
acgactcaatctgcgccgtggaaactggaagctggaacgccaaatgtcgctggtgtcata
ggattaagcgcggcgctggaatggctggcagattacgatatcaaccaggccgaaagctgg
agccgtagcttagcaacgctggcggaagatgcgctggcgaaacgtcccggctttcgttca
ttccgctgccaggattccagcctgctggcctttgattttgctggcgttcatcatagcgat
atggtgacgctgctggcggagtacggtattgccctgcgggccgggcagcattgcgctcag
ccgctactggcagaattaggcgtaaccggcacactgcgcgcctcttttgcgccatataat
acaaagagtgatgtggatgcgctggtgaatgccgttgaccgcgcgctggaattattggtg
gattaa

DBGET integrated database retrieval system