KEGG   Escherichia coli KO11FL: EKO11_0959
Entry
EKO11_0959        CDS       T01718                                 

Definition
(GenBank) protein of unknown function DUF903
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: DUF903 Pirin
Other DBs
NCBI-ProteinID: ADX49595
Position
1009474..1009701
AA seq 75 aa
MKKTAAIISACMLTFALSACSGSNYVMHTNDGRTIVSDGKPQTDNDTGMISYKDANGNKQ
QINRTDVKEMVELDQ
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaaaagactgccgcaattatttctgcctgtatgctgacttttgccctgagcgcctgt
tccggttcgaactatgtgatgcacaccaatgacggacgtaccatcgtctctgacggcaaa
ccacagactgataacgataccggtatgatttcgtataaagacgctaatggcaacaaacag
cagatcaaccgtactgacgtgaaagagatggtcgaactggatcagtaa

DBGET integrated database retrieval system