KEGG   Escherichia coli KO11FL: EKO11_0960
Entry
EKO11_0960        CDS       T01718                                 

Definition
(GenBank) transcriptional regulator, LysR family
  KO
K03566  LysR family transcriptional regulator, glycine cleavage system transcriptional activator
Organism
eko  Escherichia coli KO11FL
Pathway
eko02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eko00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    EKO11_0960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eko03000]
    EKO11_0960
Transcription factors [BR:eko03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    EKO11_0960
SSDB
Motif
Pfam: LysR_substrate HTH_1 HTH_30 MarR_2
Other DBs
NCBI-ProteinID: ADX49596
Position
1010052..1010969
AA seq 305 aa
MSKRLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSL
LLTEEGQSYFLDIKEIFSQLTEATRKLQARSAKGALTVSLLPSFAIHWLVPRLSSFNSAY
PGIDVRIQAVDRQEDKLADDVDVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGEKPL
KTPEDLAKHTLLHDASRRDWQTYTRQLGLNHINVQQGPIFSHSAMVLQAAIHGQGVALAN
NVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQAELGKIAAFRQWILAKAAAEQEKFR
FRYEQ
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtctaaacgattaccaccgctaaatgccttacgagtttttgatgccgcagcacgccat
ttaagtttcactcgcgcagcagaagagctttttgtgacccaggccgcagtaagtcatcaa
atcaagtctcttgaggattttctggggctaaaactgttccgccgccgtaatcgttcactc
ctgctgaccgaggaaggtcaaagctatttcctcgatatcaaagagatattttcgcaatta
accgaagcgacgcgtaaactccaggcccgtagcgccaagggggcgttgacggtcagttta
ctccccagtttcgccattcattggttggttccgcgactttccagctttaattcagcttat
ccgggaattgacgttcgaatccaggcggttgatcgtcaggaagataagctggcggatgat
gttgatgtggcgatattttatggtcggggcaactggccggggctacgggtggaaaaactg
tacgccgaatatttattgccggtgtgttcgccgctactgctgacaggcgaaaaacccttg
aagaccccggaagatctggctaaacatacgttattacatgatgcgtcacgccgtgactgg
cagacatatacccgacagttggggttaaatcatatcaacgttcagcaagggccaattttt
agtcatagcgccatggtgctgcaagcggctattcacgggcagggagtggcgctggcaaat
aacgtgatggcgcaatctgaaatcgaggccggacgtcttgtttgcccgtttaatgatgtt
ctggtcagtaaaaacgctttttatctggtttgtcatgacagccaggcagaactgggtaaa
atagccgcctttcgccaatggatcctggcgaaagccgctgctgaacaagaaaaattccgc
tttcgttatgaacaataa

DBGET integrated database retrieval system