KEGG   Escherichia coli KO11FL: EKO11_0961
Entry
EKO11_0961        CDS       T01718                                 

Definition
(GenBank) protein of unknown function DUF423
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: DUF423 Phage_holin_3_6
Other DBs
NCBI-ProteinID: ADX49597
Position
1010988..1011383
AA seq 131 aa
MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLEYQAFHTLAILGLAVA
MQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAFVTPVGGVSFLAGWALMLVGA
IRLKRKGVNHE
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaccagccgttttatgctgattttcgccgccattagcggcttcatttttgtggctctg
ggcgcttttggcgcgcatgtgttaagtaaaaccatgggggccgttgagatgggctggatc
cagaccggcctcgaataccaggcgtttcatacgctggcgatcttaggtctggcggtggca
atgcagcgtcgcatcagtatctggttttactggagtagcgttttcctcgcgttaggcacg
gtgttgttcagcggcagcctttattgcctggcgctgtcccatctgcgtttgtgggcgttt
gtcactccggttggcggcgtgagcttcctcgcgggctgggcgttaatgttagttggtgct
atccgtttaaagcgcaagggcgtaaatcatgaataa

DBGET integrated database retrieval system