KEGG   Escherichia coli KO11FL: EKO11_0962
Entry
EKO11_0962        CDS       T01718                                 

Definition
(GenBank) ribosomal RNA methyltransferase RrmJ/FtsJ
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eko03009]
    EKO11_0962
Enzymes [BR:eko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     EKO11_0962
Ribosome biogenesis [BR:eko03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EKO11_0962
SSDB
Motif
Pfam: RlmM_FDX FtsJ DUF4222 MIT_C
Other DBs
NCBI-ProteinID: ADX49598
Structure
PDB: 
4AUK 4ATN 4B17

Position
1011376..1012476
AA seq 366 aa
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELP
FSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFC
RKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWAAVG
GRRDER
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaataaggttgtattgctgtgccgtccgggctttgaaaaagagtgcgccgcagaaatt
accgataaagccggccagcgggaaattttcggttttgcccgcgtgaaagagaatgcgggt
tatgtcatttatgaatgttatcaacctgatgatggcgataagttaatccgtgagctgccg
ttcagttcattaatttttgcccgccagtggtttgtggtgggggaactcctgcagcatttg
ccgccagaagatcgtattacccccattgtcggcatgttacagggcgtagtagagaagggc
ggtgaactgcgtgttgaagttgccgataccaacgaaagcaaagagttactgaaattctgc
cgtaaatttactgttccgctacgcgctgccttgcgcgatgccggggtgctggcgaactat
gaaacgccgaagcgtccggttgtgcatgtattctttattgcaccaggctgctgctatacc
ggttactcatacagcaacaataattcgccgttctatatgggcattccgcgcctgaaattt
ccggcagatgcgccgagtcgttccacgctcaaactggaagaggcatttcatgtgtttatt
cctgcggatgagtgggatgaacgcctggcgaacgggatgtgggcggtggatttaggcgct
tgccctggcggctggacctaccaactggtgaagcgcaacatgtgggtttattccgtcgac
aacggcccgatggcgcaaagtctgatggataccggacaggtgacgtggctgcgggaagac
ggtttcaaattccgtccgacgcgcagcaatatctcctggatggtatgcgatatggttgaa
aaaccggcgaaagttgcggcattgatggcgcagtggctggttaatggctggtgccgtgaa
accattttcaacctcaaactgccgatgaaaaaacgctacgaagaagtgtcacacaatctg
gcgtatattcaggcacagcttgatgaacatggcataaatgctcagattcaggcgcggcag
ttgtatcacgatcgcgaagaagtgacggtgcacgtccgccgcatctgggctgcggtgggt
ggtcgtcgcgacgagcgataa

DBGET integrated database retrieval system