KEGG   Escherichia coli KO11FL: EKO11_0963
Entry
EKO11_0963        CDS       T01718                                 

Definition
(GenBank) transcriptional regulator, DeoR family
  KO
K02430  DeoR family transcriptional regulator, L-fucose operon activator
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eko03000]
    EKO11_0963
Transcription factors [BR:eko03000]
 Prokaryotic type
  Helix-turn-helix
   DeoR family
    EKO11_0963
SSDB
Motif
Pfam: DeoRC HTH_DeoR HTH_11 GntR HTH_Mga TrmB TFIIE_alpha HTH_36 HTH_PafC HTH_Crp_2 Mga HTH_9 MarR_2 HTH_AsnC-type Cullin Sigma70_r4 Arg_repressor HTH_17 DUF1670 HTH_5 Put_DNA-bind_N HTH_24 z-alpha
Other DBs
NCBI-ProteinID: ADX49599
Position
complement(1012520..1013251)
AA seq 243 aa
MKAARQQAIVDLLLNHTSLTTEALSEQLKVSKETIRRDLNELQTQGKILRNHGRAKYIHR
QNQDSGDPFHIRLKSHYAHKADIAREALAWIEEGMVIALDASSTCWYLARQLPDINIQVF
TNSHPICHELGKRERIQLISSGGTLERKYGCYVNPSLISQLKSLEIDLFIFSCEGIDSSG
ALWDSNAINADYKSMLLKRAAQSLLLIDKSKFNRSGEARIGHLDEVTHIISDERQVATSL
VTA
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaaagcggcacgccagcaagcgatagtcgacctgctgctgaaccataccagcctgacc
acggaagctctctctgaacagctaaaggtcagtaaagaaaccattcgtcgcgatctcaat
gaattacagacgcagggtaaaattctgcgcaatcatggacgcgctaaatatatccaccgt
caaaatcaagacagtggcgatccctttcacatcaggctgaaaagccattatgcgcataaa
gcagatatcgcgcgcgaggcgctcgcgtggattgaagaagggatggtgatagccttagac
gccagttcaacttgctggtatctggcacgccagttgcctgacatcaacattcaggtcttc
accaatagccatccgatttgccatgaactcggtaaacgcgaacgcattcaactgatcagt
tccggcggcacacttgagcgcaaatatggctgttacgtcaatccctcgctgatttcccaa
cttaaatcgctggaaatcgatctgtttattttttcttgtgaagggatcgatagcagcggc
gcactgtgggactccaatgcgatcaacgctgattacaaatcgatgctattaaaacgtgcc
gcgcaatcgttgttattgattgataaaagtaaatttaatcgttcaggggaagcccgcatc
gggcatctggatgaggtaacgcacattatttctgatgagcgccaggttgcaacttctttg
gtaacagcctga

DBGET integrated database retrieval system