KEGG   Escherichia coli KO11FL: EKO11_0965
Entry
EKO11_0965        CDS       T01718                                 

Definition
(GenBank) L-fuculokinase
  KO
K00879  L-fuculokinase [EC:2.7.1.51]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00051  Fructose and mannose metabolism
eko01100  Metabolic pathways
eko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EKO11_0965
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.51  L-fuculokinase
     EKO11_0965
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-ProteinID: ADX49601
Position
complement(1013733..1015181)
AA seq 482 aa
MLSGYIAGAIMKQEVILVLDCGATNVRAIAVNRQGKIVARASTPNASDIAMENNTWHQWS
LDAILQRFADCCRQINSELTECHIRGIAVTTFGVDGALVDKQGNLLYPIISWKCPRTAAV
MDNIEQLISAQRLQAISGVGAFSFNTLYKLVWLKENHPQLLERAHAWLFISSLINHRLTG
EFTTDITMAGTSQMLDIQQRDFSPQILQATGIPRRLFPRLVEAGEQIGTLQNSAAAMLGL
PVGIPVISAGHDTQFALFGAGADQNEPVLSSGTWEILMVRSAQVDTSLLSQYAGSTCELD
SQAGLYNPGMQWLASGVLEWVRKLFWTAETPWQMLIEEARLIAPGADGVKMQCDLLSCQN
AGWQGVTLNTTRGHFYRAALEGLTAQLQRNLQMLEKIGHFKASELLLVGGGSRNTLWNQI
KANMLDIPVKVLDDAETTVAGAALFGWYGVGEFNSPEEARAQIHYQYRYFYPQTEPEFIE
EV
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgttatccggctatattgcaggagcgattatgaaacaagaagttatcctggtactcgac
tgtggcgcgacaaatgtcagggccatcgcggttaatcggcagggaaaaattgttgcccgc
gcctcaacgcctaatgccagcgatatcgcgatggaaaacaacacctggcaccagtggtct
ttagacgccattttgcaacgctttgctgattgctgtcggcaaatcaatagtgaactgact
gaatgccacatccgcggtatcgccgtcaccacctttggtgtggatggcgctctggtagat
aagcaaggcaatctgctctatccgatcattagctggaaatgtccgcgaacagcagcggtt
atggacaatattgaacagttgatctccgcacagcggttgcaggctatttctggcgtcgga
gcctttagtttcaatacgttatataagttggtgtggttgaaagaaaatcatccacaactg
ctggaacgcgcgcacgcctggctctttatttcgtcgctgattaaccaccgtttaaccggc
gaattcactactgatatcacgatggccggaaccagccagatgctggatatccagcaacgc
gatttcagtccgcaaattttacaagccaccggtattccacgccgactcttccctcgtctg
gtggaagcgggtgaacagattggtacgctacagaacagcgccgcagcaatgctcggctta
cccgttggcataccggtgatttccgcaggtcacgatacccagttcgccctttttggcgct
ggtgccgaccaaaatgaacccgtgctctcttccggtacatgggaaattttaatggtccgt
agcgcccaggttgatacttcgctgttaagtcagtacgccggttccacctgcgaactggat
agccaggcagggttgtataacccaggtatgcaatggctggcatccggcgtgctggaatgg
gtgagaaaactgttctggacggctgaaacaccctggcaaatgttgattgaagaagctcgt
ctgatcgcgcctggcgcggatggcgtaaaaatgcagtgtgatttattgtcgtgtcagaac
gctggctggcaaggagtgacgcttaataccacgcgggggcatttctatcgcgcggcgctg
gaagggttaactgcgcaattacagcgcaatctacagatgctggaaaaaatcgggcacttt
aaggcctctgaattattgttagtcggtggaggaagtcgcaacacattgtggaatcagatt
aaagccaatatgcttgatattccggtaaaagttctcgacgacgccgaaacgaccgtcgca
ggagctgcgctgttcggttggtatggcgtaggggaatttaacagcccggaagaagcccgc
gcacagattcattatcagtaccgttatttctacccgcaaactgaacctgaatttatagag
gaagtgtga

DBGET integrated database retrieval system