KEGG   Escherichia coli KO11FL: EKO11_0967
Entry
EKO11_0967        CDS       T01718                                 

Definition
(GenBank) L-fucose transporter
  KO
K02429  MFS transporter, FHS family, L-fucose permease
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eko02000]
    EKO11_0967
Transporters [BR:eko02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    EKO11_0967
SSDB
Motif
Pfam: MFS_1 Sugar_tr OATP MRAP
Other DBs
NCBI-ProteinID: ADX49603
Structure
PDB: 
3O7Q 3O7P

Position
complement(1017068..1018384)
AA seq 438 aa
MGNTSIQTQSYRAVDKDAGQSRSYIIPFALLCSLFFLWAVANNLNDILLPQFQQAFTLTN
FQAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFLYALGAALFWPAAEIMNYTLF
LVGLFIIAAGLGCLETAANPFVTVLGPESSGHFRLNLAQTFNSFGAIIAVVFGQSLILSN
VPHQSQDVLDKMSPEQLSAYKHSLVLSVQTPYMIIVAIVLLVALLIMLTKFPALQSDNHS
DAKQGSFSASLSRLARIRHWRWAVLAQFCYVGAQTACWSYLIRYAVEEIPGMTAGFAANY
LTGTMVCFFIGRFTGTWLISRFAPHKVLAAYALIAMALCLISAFAGGHVGLIALTLCSAF
MSIQYPTIFSLGIKNLGQDTKYGSSFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELIPAL
CFAVIFIFARFRSQTATN
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgggaaacacatcaatacaaacgcagagttaccgtgcggtagataaagatgcagggcaa
agcagaagttacattattccattcgcgctgctgtgctcactgttttttctttgggcggta
gccaataatcttaacgacatattattacctcaattccagcaggcttttacgctgacaaat
ttccaggctggcctgatccaatcggccttttactttggttatttcattatcccaatccct
gctgggatattaatgaaaaaactcagttataaagcagggattattaccggattattttta
tatgccttgggtgctgcattattctggcccgctgcagaaataatgaactacaccttattt
ttagttggcctatttattattgcagccggattaggttgtctggaaactgccgcaaaccct
tttgttacggtattagggccggaaagcagtggtcacttccgcttaaatcttgcgcaaaca
tttaactcatttggcgcaattatcgcggttgtctttgggcaaagtcttattttgtctaac
gtgccacatcaatcgcaagacgttctcgataaaatgtctccagagcaattgagtgcgtat
aaacacagcctggtattatcggtacagacaccttatatgatcatcgtggctatcgtgtta
ctggtcgccctgctgatcatgctgacgaaattcccggcattgcagagtgataatcacagt
gacgccaaacaaggatcgttctccgcatcgctttctcgcctggcgcgtattcgccactgg
cgctgggcggtattagcgcaattctgctacgtcggcgcacaaacggcctgctggagctat
ttgattcgctacgctgtagaagaaattccaggtatgactgcaggctttgccgctaactat
ttaaccggaaccatggtgtgcttctttattggtcgtttcactggtacctggctcatcagt
cgcttcgcaccacacaaagtcctggccgcctacgcattaatcgctatggcactgtgcctg
atctcagccttcgctggcggtcatgtgggcttaatagccctgactttatgcagcgccttt
atgtcgattcagtacccaacaatcttctcgctgggcattaagaatctcggccaggacacc
aaatacggttcgtccttcatcgttatgaccatcattggcggcggtattgtcactccggtc
atgggttttgtcagtgacgcggcgggcaacatccccactgctgaactgatccccgcactc
tgcttcgcggtcatctttatctttgcccgtttccgttctcaaacggcaactaactga

DBGET integrated database retrieval system