KEGG   Escherichia coli KO11FL: EKO11_0970
Entry
EKO11_0970        CDS       T01718                                 

Definition
(GenBank) 5'-3' exonuclease, SAM-fold domain protein
  KO
K01146  protein Xni
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    EKO11_0970
SSDB
Motif
Pfam: 5_3_exonuc_N 5_3_exonuc
Other DBs
NCBI-ProteinID: ADX49606
Structure
PDB: 

Position
complement(1020809..1021654)
AA seq 281 aa
MRGLFPISHPAIACSSIECYPYRLIFKGVIVAVHLLIVDALNLIRRIHAVQGSPCVETCQ
HALDQLIMHSQPTHAVAVFDDENRSSGWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQ
RGVPCWSASGNEADDLAATLAVKVTQAGHQATIVSTDKGYCQLLSPTLRIRDYFQKRWLD
APFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSATQLLVEFQSLEGIYENLDAV
AEKWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLVR
NT seq 846 nt   +upstreamnt  +downstreamnt
ttgcgaggcctcttcccgatttctcatccagccatagcctgttccagtatcgaatgttac
ccttatcgcctgatctttaagggggttatcgtggctgttcatttgcttattgtcgatgca
ctgaatcttattcgtcgcattcatgccgttcagggttcgccctgtgtcgaaacctgccag
cacgcgctcgatcagctcattatgcacagccagccaacccacgctgtcgccgtttttgat
gatgaaaaccgcagtagcggctggcgtcatcagcgtttaccagattacaaagcgggtcga
ccgccaatgccggaagagttgcacgacgagatgcctgcattacgcgccgcctttgagcaa
cgcggcgtcccgtgctggtcagccagcggcaacgaagccgatgacttagccgccacgctg
gcggtcaaagtgacacaggccgggcatcaggcaacgattgtttcgacagataaaggctac
tgtcagttactttcaccgacattacgtattcgtgattacttccagaaacgttggctggat
gcgccatttatcgataaagaatttggcgttcaaccgcagcagttgcccgattactgggga
cttgcggggatcagcagttcaaaggtaccgggtgttgcgggaatcggaccaaaaagcgcc
acgcagctgctggtcgagtttcagagtctggaagggatatatgagaatctggatgcggtt
gccgaaaagtggcgcaaaaaattagaaacccataaagagatggcgtttctgtgccgcgat
attgcccgcttacaaaccgatttgcatatcgacggcaatttacagcaattgcggttggta
cggtaa

DBGET integrated database retrieval system