KEGG   Escherichia coli KO11FL: EKO11_0971
Entry
EKO11_0971        CDS       T01718                                 

Definition
(GenBank) L-serine dehydratase 1
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00260  Glycine, serine and threonine metabolism
eko00270  Cysteine and methionine metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01200  Carbon metabolism
eko01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EKO11_0971
   00270 Cysteine and methionine metabolism
    EKO11_0971
Enzymes [BR:eko01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     EKO11_0971
SSDB
Motif
Pfam: SDH_alpha SDH_beta MmgE_PrpD CT_C_D SAP
Other DBs
NCBI-ProteinID: ADX49607
Position
complement(1021676..1023043)
AA seq 455 aa
MISVFDIFKIGIGPSSSHTVGPMKAGKQFTDDLIARNLLKDVTRVVVDVYGSLSLTGKGH
HTDIAIIMGLAGNLPDTVDIDSIPGFIQDVNTHGRLMLANGQHEVEFPVDQCMNFHADNL
SLHENGMRITALAGDKVVYSQTYYSIGGGFIVDEEHFGQQDSAPVEVPYPYSSAADLQKH
CQETGLSLSGLMMKNELALHSKEELEQHLANVWEVMRGGIERGISTEGVLPGKLRVPRRA
AALRRMLVSQDKTTTDPMAVVDWINMFALAVNEENAAGGRVVTAPTNGACGIIPAVLAYY
DKFIREVNANSLARYLLVASAIGSLYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGA
SPAQVCIAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAVNAARMALRRTSEPRVC
LDKVIETMYETGKDMNAKYRETSRGGLAMKIVACD
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgattagcgtattcgatattttcaaaatcggcattggcccttccagttctcataccgtt
ggaccaatgaaagcgggtaaacaatttaccgacgatctgattgcccgtaacttgcttaaa
gacgtgacccgcgtggtggttgacgtgtacggctcgctctctctgaccggtaaaggccac
cacactgatatcgccataattatgggtctggcgggtaacctgccggataccgtggatatc
gattccatccccggttttattcaggatgtgaatactcatggtcgcctgatgctggcaaac
ggtcagcatgaagtggagttcccggttgatcagtgcatgaacttccacgccgacaacctt
tctctgcatgaaaacggtatgcgcattaccgcgctggcgggcgataaagtcgtttacagc
cagacttactactctattggcggtggctttatcgttgatgaagagcattttggccagcag
gatagcgcaccggttgaagttccttatccgtacagttcagcagccgatctgcaaaaacat
tgtcaggaaaccgggctgtcactctctggcctgatgatgaaaaacgagctggcgctgcac
agcaaagaagagctggaacagcacctggcgaacgtctgggaagtcatgcgcggcggtatt
gagcgcggtatttctaccgaaggcgtgttgcctggcaaactgcgcgttccacgccgtgct
gcggcactacgccggatgctggtcagccaggataaaaccaccactgacccgatggcggta
gttgactggatcaacatgtttgcactggcagtgaacgaagagaacgccgctggcggtcgc
gtggtgactgcgccgactaacggtgcgtgcgggattatcccggctgtgctggcgtactac
gataagtttatccgcgaagtgaacgctaactcactggctcgttacctgctggtagccagc
gccattggttctctttataagatgaacgcatcaatttctggtgccgaagtgggctgccag
ggtgaagttggcgtggcgtgctcaatggcggcggctggtctggcagaactattaggcgca
agcccggcgcaggtgtgcatcgcggcggaaatcgccatggagcacaacctcggtctgacg
tgtgacccggtcgccggacaggtacaggtgccatgcatcgagcgtaacgccattgcggca
gtaaaagcggtgaacgccgcacgtatggcgctgcgccgtaccagcgagccgcgcgtctgc
ctcgataaagttatcgaaaccatgtacgaaacaggtaaagatatgaacgccaagtaccgc
gaaacctctcgcggcggcctggcaatgaagatcgttgcctgcgattaa

DBGET integrated database retrieval system