KEGG   Escherichia coli KO11FL: EKO11_0972
Entry
EKO11_0972        CDS       T01718                                 

Definition
(GenBank) serine transporter
  KO
K03837  serine transporter
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eko02000]
    EKO11_0972
Transporters [BR:eko02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   EKO11_0972
SSDB
Motif
Pfam: DUF3961 ELK
Other DBs
NCBI-ProteinID: ADX49608
Position
complement(1023101..1024390)
AA seq 429 aa
METTQTSTIASKDSRSAWRKTDTMWMLGLYGTAIGAGVLFLPINAGVGGMIPLIIMAILA
FPMTFFAHRGLTRFVLSGKNPGEDITEVVEEHFGIGAGKLITLLYFFAIYPILLVYSVAI
TNTVESFMSHQLGMTPPPRAILSLILIVGMMTIVRFGEQMIVKAMSILVFPFVGVLMLLA
LYLIPQWNGAALETLSLDTASATGNGLWMTLWLAIPVMVFSFNHSPIISSFAVAKREEYG
DMAEQKCSKILAFAHIMMVLTVMFFVFSCVLSLTPADLAAAKEQNISILSYLANHFNAPV
IAWMAPIIAIIAITKSFLGHYLGAREGFNGMVIKSLRGKGKSIEINKLNRITALFMLVTT
WIVATLNPSILGMIETLGGPIIAMILFLMPMYAIQKVPAMRKYSGHISNVFVVVMGLIAI
SAIFYSLFS
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggaaacgactcaaaccagcacgattgcgtcgaaagactctcgtagtgcctggcgcaag
acagacaccatgtggatgctgggcctttacggcacggcaatcggcgcgggcgtgctgttc
ctgccaatcaacgccggtgttggcggtatgatcccgctgatcatcatggctatccttgcg
ttcccgatgacgttttttgctcaccgcggcctgactcgcttcgtactgtctggtaaaaac
ccgggcgaagacatcaccgaggttgtagaagaacactttggtattggcgcaggtaaactg
attaccctgctctacttcttcgctatctacccgatcctgctggtttatagcgtggcaatc
accaatacagttgaaagcttcatgtctcaccagctgggtatgacgccaccgccgcgtgcg
attctgtcgctgatcctgatcgtgggtatgatgaccatcgttcgcttcggtgagcagatg
atcgttaaagcgatgagtattctggtattcccgtttgttggcgtactgatgctgctggct
ctgtacctcatcccgcagtggaacggcgcagcactggaaacgctgtctctggacactgca
tctgcaaccggaaacggtctgtggatgaccctgtggctggcaattccggtaatggtgttc
tcgttcaaccactctccgatcatctcttctttcgccgttgcgaagcgtgaagagtacggc
gatatggcagaacagaaatgctcgaagatcctggcattcgcacacatcatgatggtgctg
accgtaatgttcttcgtcttcagctgcgtactgagcctgactccggcagacctggctgca
gctaaagagcagaacatctcgattctgtcttacctggctaaccactttaacgcaccggtt
atcgcgtggatggctccgattatcgcgattatcgctatcaccaaatccttcctcggccac
tacctgggcgcacgtgaaggcttcaacggtatggtgattaaatctctgcgtggtaaaggt
aagtctatcgaaatcaacaagctgaaccgtatcactgcgctgttcatgctggtaacgacc
tggattgttgccaccctgaacccgagcatcctgggtatgattgaaaccctgggcggccca
atcatcgcgatgatcctgttcctgatgccgatgtacgcaattcagaaagtaccggcaatg
cgtaagtacagcggtcacatcagcaacgtattcgttgtcgtgatgggtctgattgcaatc
tccgcaatcttctactctctgttcagctaa

DBGET integrated database retrieval system